Search Results

Search found 21349 results on 854 pages for 'thought space designs'.

Page 112/854 | < Previous Page | 108 109 110 111 112 113 114 115 116 117 118 119  | Next Page >

  • add ANOTHER primary key to a table which is UNIQUE

    - by gdubs
    so im having problems with adding another primary key to my table. i have 3 columns: 1. Account ID (Identity) 2. EmailID 3. Data field when i made the table i had this to make the Account ID and the Email ID unique PRIMARY KEY (AccountID, EmailID) i thought that would make my emailid unique, but then after i tried inserting another row with the same emailid it went through. so i thought i missed something out. now for my question: IF, i had to use alter, How do i alter the table/PK Constraint to modify the EmailID field and make it Unique IF i decided to drop the table and made a new one, how do i make those two primary keys uniqe? Thanks a bunch!!

    Read the article

  • Ajax data two-way data binding strategies?

    - by morgancodes
    I'd like to 1) Draw create form fields and populate them with data from javascript objects 2) Update those backing objects whenever the value of the form field changes Number 1 is easy. I have a few js template systems I've been using that work quite nicely. Number 2 may require a bit of thought. A quick google search on "ajax data binding" turned up a few systems which seem basically one-way. They're designed to update a UI based on backing js objects, but don't seem to address the question of how to update those backing objects when changes are made to the UI. Can anyone recommend any libraries which will do this for me? It's something I can write myself without too much trouble, but if this question has already been thought through, I'd rather not duplicate the work.

    Read the article

  • Fixed footer with 960.gs

    - by Oguz
    I want to create fixed footer but , is it possible with 960 gs , because I am having trouble with height of container div . I can no set it to %100. <div class="container_12" > <div class="grid_3" id="side-space"></div> <div class="grid_6"> <div id="content-box"></div> </div> <div class="grid_3" id="side-space"></div> </div>

    Read the article

  • increasing amazon root volume size

    - by OCD
    I have a default amazon ec2 instance with 8GB root volume size. I am running out of space. I have: Detach the current EBS volume in AWS Management Console (Web). Create snapshot of this volume. Created a new Volume with 50G space with my snapshot. Attach the new volume back to the instance to /dev/sda1 However, when I reconnect to the account with: > df -h I can see from the management console that my new Filesystem 1K-blocks Used Available Use% Mounted on /dev/xvda1 8256952 8173624 0 100% / tmpfs 308508 40 308468 1% /dev/shm It's still not using my new volume's size, how to make this work?

    Read the article

  • GeoDjango: is there an out-of-the-box way to generate clusters of points?

    - by vaughnkoch
    Hi, I'm trying to compute clusters on a set of points in Python, using GeoDjango. The problem: Given a set of points, output a set of clusters of those points. (i'm fine specifying # of clusters/cluster size/distance in advance to simplify) There are a few solutions on the web to do clustering, so it's a well known problem. I thought that GeoDjango would handle these types of problems out of the box, but it's not clear how - I've searched the GeoDjango documentation, Google, and a few other places, but couldn't find anything. Before I roll my own clustering solution, I thought I'd ask to see if there's a straightforward way to do this using GEOS or another package within GeoDjango.

    Read the article

  • IE Problem: Jagged Scrolling and Dragging Inside Large Viewport

    - by br4inwash3r
    My site is a single page website with a very large "canvas" size. and to navigate around the site i'm using jquery scrollTo and jquery Dragscrollable plugin. in IE 7 & 8 the scrolling/dragging movement is very jagged. at first i thought it was my script or some other plugin that's causing this. but after i stripped down everything it's still the same. i've tried a few tips i've found around here. but none is really working for me. i know i should be asking this question to the plugin developers. i did.. i just thought maybe you guys have some other solution for this issue. here's the URL to the demo site: http://satuhati.com/bare/template/ really appreciate any help u can give :) thx..

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What Regex can strip e.g. "note:" and "firstName: " from the left of a string?

    - by Edward Tanguay
    I need to strip the "label" off the front of strings, e.g. note: this is a note needs to return: note and this is a note I've produced the following code example but am having trouble with the regexes. What code do I need in the two ???????? areas below so that I get the desired results shown in the comments? using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Text.RegularExpressions; namespace TestRegex8822 { class Program { static void Main(string[] args) { List<string> lines = new List<string>(); lines.Add("note: this is a note"); lines.Add("test: just a test"); lines.Add("test:\t\t\tjust a test"); lines.Add("firstName: Jim"); //"firstName" IS a label because it does NOT contain a space lines.Add("She said this to him: follow me."); //this is NOT a label since there is a space before the colon lines.Add("description: this is the first description"); lines.Add("description:this is the second description"); //no space after colon lines.Add("this is a line with no label"); foreach (var line in lines) { Console.WriteLine(StringHelpers.GetLabelFromLine(line)); Console.WriteLine(StringHelpers.StripLabelFromLine(line)); Console.WriteLine("--"); //note //this is a note //-- //test //just a test //-- //test //just a test //-- //firstName //Jim //-- // //She said this to him: follow me. //-- //description //this is the first description //-- //description //this is the first description //-- // //this is a line with no label //-- } Console.ReadLine(); } } public static class StringHelpers { public static string GetLabelFromLine(this string line) { string label = line.GetMatch(@"^?:(\s)"); //??????????????? if (!label.IsNullOrEmpty()) return label; else return ""; } public static string StripLabelFromLine(this string line) { return ...//??????????????? } public static bool IsNullOrEmpty(this string line) { return String.IsNullOrEmpty(line); } } public static class RegexHelpers { public static string GetMatch(this string text, string regex) { Match match = Regex.Match(text, regex); if (match.Success) { string theMatch = match.Groups[0].Value; return theMatch; } else { return null; } } } }

    Read the article

  • ack (perl?) regexp matching lines where if is the first word

    - by Gauthier
    Hey. I'm finally learning regexps, training with ack. I believe this uses perl regexp. I want to match all lines where the first non-blank characters are if (<word> !, with any number of spaces in between the elements. This is what I came up with: ^[ \t]*if *\(\w+ *! It only nearly worked. ^[ \t]* is wrong, since it matches one or none [space or tab]. What I want is to match anything that may contain only space or tab (or nothing). For example these should not match: // if (asdf != 0) else if (asdf != 1) How can I modify my regexp for that?

    Read the article

  • declarative authorization and has_and_belongs_to_many

    - by Michael Balsiger
    Hi, I have a little problem with declarative-authorization. I have a User and Role Model with a has_and_belongs_to_many association. I've created a Role named :moderator in my authorization_rules.rb Is it possible that a User with the Role Moderator only gets the Users that have the Moderator Role assigned to it?? -- User.with_permissions_to(:index) I thought it would be possible like that: role :moderator do has_permission_on :users, :to => :index do if_attribute :roles => contains { ????? } end end I also created a named_scope in my User Model because I thought it would help... class User has_and_belongs_to_many :roles named_scope :by_role, lambda { |role| { :include => :roles, :conditions => {"roles.name" => role} } } end Does anyone knows if it's possible to do this with declarative_authorization? Thanks for your help!

    Read the article

  • Variable length Blob in hibernate?

    - by Seth
    I have a byte[] member in one of my persistable classes. Normally, I'd just annotate it with @Lob and @Column(name="foo", size=). In this particular case, however, the length of the byte[] can vary a lot (from ~10KB all the way up to ~100MB). If I annotate the column with a size of 128MB, I feel like I'll be wasting a lot of space for the small and mid-sized objects. Is there a variable length blob type I can use? Will hibernate take care of all of this for me behind the scenes without wasting space? What's the best way to go about this? Thanks!

    Read the article

  • Websites with horizontal sliding panels

    - by peterdp
    In a recent meeting, I mentioned that I've seen a few websites with horizontal sliding panels and thought the UI was elegant, uncluttered and accessible. Naturally, I was asked to provide examples of those sites, but can't seem to dig up any of them now. Actually, I've been looking on an off for the past few days. (blush) Sooo.... I thought that I would put it out to the brilliant and talented folks who frequent StackOverflow. If you know of a website -- or better yet, have a website -- that uses horizontal sliding panels to provide rich functionality while maintaining a clean UI, would you please take a few moments and paste links here? I'm sure it would be helpful to a bunch o' folks. Thanks so very much!

    Read the article

  • Way to get VS 2008 to stop forcing indentation on namespaces?

    - by Earlz
    I've never really been a big fan of the way most editors handle namespaces. They always force you to add an extra pointless level of indentation. For instance, I have a lot of code in a page that I would much rather prefer formatted as namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } and not something like namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } Honestly, I don't really even like the class thing being indented most of the time because I usually only have 1 class per file. And it doesn't look as bad here, but when you get a ton of code and lot of scopes, you can easily have indentation that forces you off the screen, and plus here I just used 2-space tabs and not 4-space as is used by us. Anyway, is there some way to get Visual Studio to stop trying to indent namespaces for me like that?

    Read the article

  • App only spawns one thread

    - by tipu
    I have what I thought was a thread-friendly app, and after doing some output I've concluded that of the 15 threads I am attempting to run, only one does. I have if __name__ == "__main__": fhf = FileHandlerFactory() tweet_manager = TweetManager("C:/Documents and Settings/Administrator/My Documents/My Dropbox/workspace/trie/Tweet Search Engine/data/partitioned_raw_tweets/raw_tweets.txt.001") start = time.time() for i in range(15): Indexer(tweet_manager, fhf).start() Then in my thread-entry point, I do def run(self): print(threading.current_thread()) self.index() That results in this: <Indexer(Thread-3, started 1168)> So of 15 threads that I thought were running, I'm only running one. Any idea as to why? Edit: code

    Read the article

  • Portable way of finding total disk size in Java (pre java 6)

    - by Wouter Lievens
    I need to find the total size of a drive in Java 5 (or 1.5, whatever). I know that Java 6 has a new method in java.io.File, but I need it to work in Java 5. Apache Commons IO has org.apache.commons.io.FileSystemUtils to provide the free disk space, but not the total disk space. I realize this is OS dependant and will need to depend on messy command line invocation. I'm fine with it working on "most" systems, i.e. windows/linux/macosx. Preferably I'd like to use an existing library rather than write my own variants. Any thoughts? Thanks.

    Read the article

  • Raw Video file from website

    - by Charlie
    I would like to make an app that will download videos files that can be played later. At first i thought I could have a UIWeb view and then try to access the cache of it and get the file that way but unfortunately i don't have access to that. After trying that my next thought would be get the direct link to the video file. Essentially what download helper does on fire fox. Any idea of where i could look at for help or any body have any better idea? Is there any stringByEvaluatingjavascript that might be of use or is there away to access the cache on a webview in your own app? Thanks for any help!

    Read the article

  • jquery ui modal dialog problems in IE

    - by JohnM2
    I use jquery ui dialog widget. Everything works fine in FF, Opera etc., except IE. The problem is that when dialog is opened in Internet Explorer, some space (not covered with that "modal gray layer") is added at the bottom of the document, and page is scrolled to the bottom. So I don't even see the dialog, I have to scroll up, to see it fully. Anyone had that problems? Any solutions? EDIT: now I see, that this "bottom space" is also added in FireFox, but it doesn't scroll to it like in IE.

    Read the article

  • SVN Best practice for a "branch" of your main product ?

    - by Steffen
    At my job we develop websites - however now we're going to make a "whitelabelled" version of a site, which basically means it's the same site, however with a different logo and hosted on a different domain. Also it'll have minor graphical differences, but overall the engine is the same. My initial thought for keeping this in SVN, was to just make a branch for it - however I'm not quite certain if this could give me trouble later on. Normally I keep my branches somewhat short lived - mainly used for developing a new feature, without disturbing trunk. We need to be able to merge trunk changes into this "whitelabel" version, which I why I thought about branching it in the first place. So what's the best way to archive this ?

    Read the article

  • Shrink database after removing extra data

    - by Sergey Osypchuk
    We have a need to fit database in 4G in order to use ms sql express edition. I started from 7G database, and found a lot of not needed records, and deleted them. After Shrink database size is 4.6G, and 748MB is free (according to database properties). However, when i execute exec sp_spaceused i am having interesting results: DatabaseName Database_size unallocation space xxxxxx 4726.50 MB 765.42 MB Reserved Data index_size unused 3899472 KB 1608776 KB 1448400 KB 842296 KB Any ideas, how can i bite at least some of this unused space? Also I know table, which occupied it. update: is it worth to try to rebuild table indexes? ALTER INDEX ALL ON Production.Product REBUILD

    Read the article

  • Detect Rotation of a scanned image in C#

    - by ahmed fouad
    We want a c# solution to correct the scanned image because it is rotated. To solve this problem we must detect the rotation angle first and then rotate the image. This was our first thought for our problem. But then we thought image warping would be more accurate as I think it would make the scanned image like our template. Then we can process it as we know all the coordinates of our template... I searched for a free SDK or a free solution in c#. Helping me in this will be great as it is the last task in our work. Really, thanks for all.

    Read the article

  • How does a programmer think?

    - by Gordon Potter
    This may be a hopelessly vague question. But I am interested to hear whatever logical thought processes people go through when learning a new concept or trying to get their brain around code they might not have ever seen before. Basically, what general steps does one take to to break down problems and what does it take to "get it"? If you were to diagram a flowchart of how your mental process works when you look at code or try to solve a problem what might it look like? What common references, tips, and mental assumptions do you find useful in problem solving? How is this different between different domains? For example in what ways is a web programmer's thought process similar or different from a traditional desktop app developer's process?

    Read the article

  • How do I set default values on new properties for existing entities after light weight core data migration?

    - by Moritz
    I've successfully completed light weight migration on my core data model. My custom entity Vehicle received a new property 'tirePressure' which is an optional property of type double with the default value 0.00. When 'old' Vehicles are fetched from the store (Vehicles that were created before the migration took place) the value for their 'tirePressure' property is nil. (Is that expected behavior?) So I thought: "No problem, I'll just do this in the Vehicle class:" - (void)awakeFromFetch { [super awakeFromFetch]; if (nil == self.tirePressure) { [self willChangeValueForKey:@"tirePressure"]; self.tirePressure = [NSNumber numberWithDouble:0.0]; [self didChangeValueForKey:@"tirePressure"]; } } Since "change processing is explicitly disabled around" awakeFromFetch I thought the calls to willChangeValueForKey and didChangeValueForKey would mark 'tirePresure' as dirty. But they don't. Every time these Vehicles are fetched from the store 'tirePressure' continues to be nil despite having saved the context.

    Read the article

  • how Can we get the output format to CSV instead of HTML in Alfresco using webscripts?

    - by pavan123
    how Can we change the output format to CSV instead of HTML in Alfresco using webscripts? below are the my corresponding FTL and Webscript files recursive.get.html.ftl <#macro recurse_macro node depth> <#if node.isContainer> <tr> <td> ${node.properties.name} </td> <td></td> </tr> <#list node.children as child> <#if child.isContainer> <@recurse_macro node=child depth=depth+1/> <#list child.children as child2> <#if child2.isDocument> <tr><td></td><td>${child2.properties.name}</td></tr> </#if> </#list> </#if> </#list> </#if> </#macro> Recursive Listing of Spaces & Documents: Space Document recursive.get.desc.xml <webscript> <shortname>recurcive</shortname> <description>Recursive</description> <url>/sample/recursive/{recursive}</url> <format default="html">extension</format> <authentication>guest</authentication> </webscript> and html output is Recursive Listing of Spaces & Documents: Space Document Company Home Data Dictionary Space Templates Software Engineering Project Documentation Drafts Pending Approval Published Samples system-overview.html Discussions UI Design Presentations Quality Assurance Presentation Templates doc_info.ftl localizable.ftl my_docs.ftl my_spaces.ftl my_summary.ftl translatable.ftl recent_docs.ftl general_example.ftl my_docs_inline.ftl show_audit.ftl readme.ftl Email Templates notify_user_email.ftl invite_user_email.ftl RSS Templates RSS_2.0_recent_docs.ftl Saved Searches admin Scripts backup.js example test script.js backup and log.js append copyright.js alfresco docs.js test return value.js Web Scripts org alfresco sample blogsearch.get.js blogsearch.get.atom.ftl blogsearch.get.desc.xml blogsearch.get.html.ftl blogsearch.get.html.400.ftl blogsearch.get.atom.400.ftl categorysearch.get.js categorysearch.get.atom.ftl categorysearch.get.desc.xml categorysearch.get.html.ftl categorysearch.get.html.404.ftl categorysearch.get.atom.404.ftl folder.get.js folder.get.atom.ftl folder.get.desc.xml folder.get.html.ftl avmstores.get.desc.xml avmstores.get.html.ftl avmbrowse.get.js avmbrowse.get.desc.xml avmbrowse.get.html.ftl recursive.get.desc.xml recursive.get.html.ftl sgs.get.desc.xml sgs.get.csv.ftl sample1.get.desc.xml sample1.get.csv.ftl first.get.desc.xml first.get.text.ftl rag.get.html.ftl rag.get.desc.xml new1.get.desc.xml new1.get.html.ftl excel.get.html.ftl excel.get.desc.xml sgs1.get.desc.xml one.get.html.ftl one.get.desc.xml one.get.js readme.html Web Scripts Extensions readme.html Guest Home Alfresco-Tutorial.pdf User Homes isabel Users Home

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

  • Internet Explorer changes brightness

    - by Sale
    I have a very annoying problem with IE8 on Vista: My screen brightness changes when I view a page with IE. It slowly dimms brightness some 20% - enough to be noticeable. This seems to be dependent on the OVERALL brightness of the page viewed or of the amount of bright space on the page... sometimes it dimms down if the page is bright, sometimes the complete different, it dimms when lot of dark space is on the page. I know this sounds weird, I cannot describe it better. It takes about one,two seconds from on brightness level to the other. This ONLY occurs in IE - not in Word or any other application. Please help! This dimming is very stressfull for my eyes.

    Read the article

< Previous Page | 108 109 110 111 112 113 114 115 116 117 118 119  | Next Page >