Search Results

Search found 8593 results on 344 pages for 'regular expression'.

Page 225/344 | < Previous Page | 221 222 223 224 225 226 227 228 229 230 231 232  | Next Page >

• Oracle AQ dequeue order

  - by yawn

  A trigger in an Oracle 10g generates upsert and delete messages for a subset of rows in a regular table. These messages consist out of two fields: A unique row id. A non-unique id. When consuming these message I want to impose an order on the deque process that respects the following constraints: Messages must be dequeued in insertion order. Messages belonging to the same id must be dequeued in such a fashion that no other dequeuing process should be able to dequeue a potential successor message (or messages) with this id. Since the messages are generated using a trigger I cannot use groups for this purpose. I am using the Oracle Java interface for AQ. Any pointers on how that could be achieved?

  Read the article

• Mirror a git repository by pulling?

  - by corydoras

  I am wondering if there is an easy way, ie like a simple cron job, to regularly pull from a remote git repository to a local read only mirror for backup purposes? Ideally it would pull all branches and tags, but the master/trunk/head would be sufficient. I just need a way to make sure that if the master git server dies, we have a backup location that we could manually fail over to. (I have been googling and reading documentation for help on how to do this for quite some time now and the furthest I have gotten is a bash script that does pull's on a regular interval.)

  Read the article

• SImplifying with LINQ - Basic selection

  - by baron

  Hello foreach (var person in peopleList.Where(person => person.FirstName == "Messi")) { selectPeople.Add(person); } I am just wondering if there is any way to simplify this using LINQ. Like rather than look at all the people I was trying to use LINQ to just fill a list with the "Messi"'s... was trying something like... var selectPeople = peopleList.Select(x=>x.FirstName=="Messi"); Then I could just add everyone in that list without a check. But it doesn't quite work as planned. Maybe there's no point simplifying that expression. But the question seemed worthwhile just to strengthen my LINQ knowledge.

  Read the article

• Flash AS3 and XML: way to fix line breaks in htmlText that uses <b> tags in the xml?

  - by HeroicNate

  I'm importing text in from an xml file and i'm using htmlText to try to keep some styling with tags. I have both the regular and bold face font embedded, and the bolding works fine. The problem is that it ads spaces around the words in bold like a paragraph indent and then makes a line-break after them. What's going on, is there a way to fix? fromxmlText.htmlText = theXML.contenttext; If I pull the text in from a txt file it will work fine, but taking it out of an xml file causing funky formatting. lil' help?

  Read the article

• RegEx, matching if not containing...

  - by Tommy Jakobsen

  I've been trying to figure out how to write this regular expression. It is to be used for ISAPI_Rewrite, a module for IIS 6, for doing URL rewriting. I want the url /hg/<parameter> to be mathed, so it can be rewrited to /hg/hgwebdir.cgi/<parameter>. I've matched it using ^/hg/(.*). My problem is, if the URL /hg/hgwebdir.cgi/<parameter> is used, the regex should NOT match. Using the above regex with this URL, will rewrite to /hg/hgwebdig.cgi/hgwebdig.cgi/<parameter> which is not correct. Can you help me create the matching pattern?

  Read the article

• Is it bad practice to extend the MongoEngine User document?

  - by Soviut

  I'm integrating MongoDB using MongoEngine. It provides auth and session support that a standard pymongo setup would lack. In regular django auth, it's considered bad practice to extend the User model since there's no guarantee it will be used correctly everywhere. Is this the case with mongoengine.django.auth? If it is considered bad practice, what is the best way to attach a separate user profile? Django has mechanisms for specifying an AUTH_PROFILE_MODULE. Is this supported in MongoEngine as well, or should I be manually doing the lookup?

  Read the article

• How to calculate unbound column value based on value of bound colum in DatagGridView?

  - by Wodzu

  Hi. I have few columns in my DataGridView, one of them is an unbound column and the DataGridVIew is in VirtualMode. When CellValueNeeded event is called, I want to calculate value of Cells[0] basing on the value of Cells[2] which is in bounded column to the underlaying DataSource. This is how I try to do this: private void dgvItems_CellValueNeeded(object sender, DataGridViewCellValueEventArgs e) { e.Value = dgvItems.CurrentRow.Cells[2].Value * 5; //simplified example } However, I am getting System.StackOverflowException because it seams that call to dgvItems.CurrentRow.Cells[2].Value results in call to another CellValueNeeded event. And so on and so on... However Cells[2] is not an unbound column, so on common sense it should not result in recursive call unless getting value of any column(bound or unbound) firest that event... I can not use here SQL Expression and I can not precalculate e.Value in any SQL call. In real example Cells[2].Value is a key used in HashTable which will return a correct value for the Cells[0] (e.Value). What can I do?

  Read the article

• python optparse, how to include additional info in usage output?

  - by CarpeNoctem

  Using python's optparse module I would like to add extra example lines below the regular usage output. My current help_print() output looks like this: usage: check_dell.py [options] options: -h, --help show this help message and exit -s, --storage checks virtual and physical disks -c, --chassis checks specified chassis components I would like it to include usage examples for the less *nix literate users at my work. Something like this: usage: check_dell.py [options] options: -h, --help show this help message and exit -s, --storage checks virtual and physical disks -c, --chassis checks specified chassis components Examples: check_dell -c all check_dell -c fans memory voltage check_dell -s How would I accomplish this? What optparse options allow for such? Current code: import optparse def main(): parser = optparse.OptionParser() parser.add_option('-s', '--storage', action='store_true', default=False, help='checks virtual and physical disks') parser.add_option('-c', '--chassis', action='store_true', default=False, help='checks specified chassis components') (opts, args) = parser.parse_args()

  Read the article

• Why does null need to be casted?

  - by BlueRaja The Green Unicorn

  The following code does not compile: //int a = ... int? b = (int?) (a != 0 ? a : null); In order to compile, it needs to be changed to int? b = (a != 0 ? a : (int?) null); Since both b = null and b = a are legal, this doesn't make sense to me. Why does null need to be casted, and why can't we simply cast the whole expression (which I know is legal in other cases)?

  Read the article

• PostgreSQL 8.3 data types: xml vs varchar

  - by Sejanus

  There's xml data type in Postgres, I never used it before so I'd like to hear opinions. Downsides and upsides vs using regular varchar (or Text) column to store xml. The text I'm going to store is xml, well-formed, UTF-8. No need to search by it (I've read searching by xml is slow). This XML actually is data prepared for PDF generation with Apache FOP. XML can be generated dynamically from data found elsewhere (other Postgres tables), it's stored as is only so that I won't need to generate it twice. Kinda backup#2 for already generated PDF documents. Anything else to know? Good practices, performance, maintenance, etc?

  Read the article

• Transforming a string to a valid PDO_MYSQL DSN

  - by Alix Axel

  What is the most concise way to transform a string in the following format: mysql:[/[/]][user[:pass]@]host[:port]/db[/] Into a usuable PDO connection/instance (using the PDO_MYSQL DSN), some possible examples: $conn = new PDO('mysql:host=host;dbname=db'); $conn = new PDO('mysql:host=host;port=3307;dbname=db'); $conn = new PDO('mysql:host=host;port=3307;dbname=db', 'user'); $conn = new PDO('mysql:host=host;port=3307;dbname=db', 'user', 'pass'); I've been trying some regular expressions (preg_[match|split|replace]) but they either don't work or are too complex, my gut tells me this is not the way to go but nothing else comes to my mind. Any suggestions?

  Read the article

• Theory of computation - Using the pumping lemma for context free languages

  - by Tony

  I'm reviewing my notes for my course on theory of computation and I'm having trouble understanding how to complete a certain proof. Here is the question: A = {0^n 1^m 0^n | n>=1, m>=1} Prove that A is not regular. It's pretty obvious that the pumping lemma has to be used for this. So, we have |vy| = 1 |vxy| <= p (p being the pumping length, = 1) uv^ixy^iz exists in A for all i = 0 Trying to think of the correct string to choose seems a bit iffy for this. I was thinking 0^p 1^q 0^p, but I don't know if I can obscurely make a q, and since there is no bound on u, this could make things unruly.. So, how would one go about this?

  Read the article

• Regex to validate SMTP Responses?

  - by Alix Axel

  I'm writing a regular expression that can interactively validate SMTP responses codes, once the SMTP dialog is completed it should pass the following regex (some parentheses added for better readability): ^(220)(250){3,}(354)(250)(221)$ Or with(out) authentication: ^(220)(250)((334){2}(235))?(250){2,}(354)(250)(221)$ I'm trying to do rewrite the above regexes so that I can interactively check if the dialog is going as expected, otherwise politely send a QUIT command and close the connection saving bandwidth and time, but I'm having a hard time writing an optimal regex. So far I've managed to come up with: ^(220(250(334(235(250(354(250(221)?)?)?){0,})?){0,2})?)?$ Which, besides only matching authenticated connections, has some bugs... For instance, it matches: 220250334235250354250221 220250334334235250354250221 I've also tried the following modification: ^(220(250)?)?((334(235)?){2})?(250(354(250(221)?)?)?){0,}$ This one accepts non-authenticated responses but it fails to match 220250334 and wrongly matches 220250334334235250354250221 (at least 2 250 are needed before the 354 response code). Can someone help me out with this? Thanks in advance.

  Read the article

• How do you authenticate user generated "apps" for your app?

  - by Brian Armstrong

  I'm think something like Facebook apps here. User generated pieces of code that people can write to interact with my app. I understand how an authenticated API works, but this seems a little more complicated because not only does the APP have to authenticate itself (with a regular api-key) but the USER using the app has to be authenticated somehow too, without giving the app free reign. I've been reading a bit here to see how FB does it: http://wiki.developers.facebook.com/index.php/How_Facebook_Authenticates_Your_Application And it looks like you have to pass a signature in addition to the api-key along with every call, but I'm having trouble wrapping my head around how this gets generated and used on the other end (my server). Figure there must be a simple explanation of this out there? Thanks! P.S. I'm building a Rails app if there are any applicable gems/plugins.

  Read the article

• Multithreading in Lua

  - by RCIX

  I was having a discussion with my friend the other day. I was saying how that, in pure Lua, you couldn't build a preemptive multitasking system. He claims you can, because of the following reason: Both C and Lua have no inbuilt threading libraries [OP's note: well, Lua technically does, but AFAIK it's not useful for our purposes]. Windows, which is written in mostly C(++) has pre-emptive multitasking, which they built from scratch. Therefore, you should be able to do the same in Lua. The big problem i see with that is that the main way preemptive multitasking works (to my knowledge) is that it generates regular interrupts which the manager uses to get control and determine what code it should be working on next. I also don't think Lua has any facility that can do that. My question is: is it possible to write a pure-Lua library that allows people to have pre-emptive multitasking?

  Read the article

• Java RandomAccessFile - dealing with different newline styles?

  - by waitinforatrain

  Hey, I'm trying to seek through a RandomAccessFile, and as part of an algorithm I have to read a line, and then seek backwards from the end of the line E.g String line = raf.readLine(); raf.seek (raf.getFilePointer() - line.length() + m.start() + m.group().length()); //m is a Matcher for regular expressions I've been getting loads of off-by-one errors and couldn't figure out why. I just discovered it's because some files I'm reading from have UNIX-style linefeeds, \r\n, and some have just windows-style \n. Is there an easy to have the RandomAccessFile treat all linefeeds as windows-style linefeeds?

  Read the article

• iphone - passing an object on an UIToolbarButton action

  - by Mike

  Is that possible to make a UIToolbarButton pass an object to its target by using some exoteric method (as it seems not to be possible using regular button use)? I mean something like UIBarButtonItem *Button = [[UIBarButtonItem alloc] initWithImage:buttonImage style:UIBarButtonItemStylePlain target:self action:@selector(doSomething:) **withObject:usingThis**]; I know I can trigger a method that will launch the full method with the object, but for the sake of elegance I was trying to minimize the code... I suspect it is not possible, but as you guys out there are insanely good you may come with an transcendental answer... who knows...

  Read the article

• Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

  - by lmonson

  I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

  Read the article

• ASP.NET GridView sorting on method data

  - by husainnz

  Hi, I'm binding a GridView to a domain model object, this domain model object has a method for working out a formatted value to display on the grid. I'd like to use this method for my display value, which is fine, but I'd also like to be able to sort on the value returned by that method. My sort expression can only take in a property/field at the moment. Help please! What do I need to do to get this to work? I'm using an SPGridView actually, but that doesn't make a lot of difference to my problem. Thanks.

  Read the article

• [AS3] htmlText not showing bold or italics font

  - by Conor

  So I have a MovieClip asset with a dynamic textfield sitting inside of it. I export my .fla as a .swc to use within Flash Builder 4, and create instances of the asset with code, populating the text dynamically from XML. My issue is that even though I have htmlText enabled, bold and italics tags don't appear to be working. I have a feeling it is because when I created the asset in Flash CS4, the text field makes you specify the font, and the subset of that to use (Regular, Bold, Oblique, etc). Is there any way to get the htmlText to render bold and italics tags properly without having to completely rethink the way I'm creating all these fields?

  Read the article

• Best way to parse command line arguments in C#

  - by Paul Stovell

  When building console applications that take parameters, you can use the arguments passed to Main(string[] args). In the past I've simply indexed/looped that array and done a few regular expressions to extract the values. However, when the commands get more complicated, the parsing can get pretty ugly. More recently, I built the world's simplest Backus-Naur Form parser in C# to parse the arguments. It does the job, but it also feels like overkill. So I'm interested in: Libraries that you use Patterns that you use Assume the commands always adhere to common standards such as answered here.

  Read the article

• count of distinct acyclic paths from A[a,b] to A[c,d]?

  - by Sorush Rabiee

  I'm writing a sokoban solver for fun and practice, it uses a simple algorithm (something like BFS with a bit of difference). now i want to estimate its running time ( O and omega). but need to know how to calculate count of acyclic paths from a vertex to another in a network. actually I want an expression that calculates count of valid paths, between two vertices of a m*n matrix of vertices. a valid path: visits each vertex 0 or one times. have no circuits for example this is a valid path: but this is not: What is needed is a method to find count of all acyclic paths between the two vertices a and b. comments on solving methods and tricks are welcomed.

  Read the article

• VB to C# conversion incongruency with lambdas

  - by Jason

  I have a bit of code that I have been tasked with converting to C# from VB. A snippet of mine seems like it cannot be converted from one to the other, and if so, I just don't know how to do it and am getting a little frustrated. Here's some background: OrderForm is an abstract class, inherited by Invoice (and also PurchaseOrder). The following VB snippet works correctly: Dim Invs As List(Of OrderForm) = GetForms(theOrder.OrderID) .... Dim inv As Invoice = Invs.Find( Function(someInv As Invoice) thePO.SubPONumber = someInv.SubInvoiceNumber) In C#, the best I came to converting this is: List<OrderForm> Invs = GetForms(theOrder.OrderID); .... Invoice inv = Invs.Find( (Invoice someInv) => thePO.SubPONumber == someInv.SubInvoiceNumber); However, I get the following error when I do this: Cannot convert lambda expression to delegate type 'System.Predicate' because the parameter types do not match the delegate parameter types Is there any way to fix this without restructuring my whole codebase?

  Read the article

• Why won't binding to a child object property with rdlc Report work in vs2010?

  - by andrej351

  A while ago someone asked how to bind to a child object's property in a rdlc report. Question here. The solution was to use an expression like this: =Fields!ChildObject.Value.SomeProperty I have recently tried to upgrade to version 10 of the reporting libraries (Microsoft.ReportViewer.WebForms and Microsoft.ReportViewer.Common) and for some reason this does not work anymore. I have got the report rendering and displaying all data fine except any which uses this technique. Instead of the property value i get the text: "#Error" Why doesn't this work anymore? Anybody know how to to this in the new version?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

< Previous Page | 221 222 223 224 225 226 227 228 229 230 231 232  | Next Page >