Search Results

Search found 8593 results on 344 pages for 'regular expression'.

Page 227/344 | < Previous Page | 223 224 225 226 227 228 229 230 231 232 233 234  | Next Page >

• What logic operator to use, as3?

  - by VideoDnd

  What operator or expression can I use that will fire on every number, including zero? I want a logic operator that will fire with ever number it receives. My animations pause at zero. This skips on zero if (numberThing> 0); This skips on 9 if (numberThing>> 0); This jitters 'fires quickly and goes back on count' if (numberThing== 0); EXPLANATION I'm catching split string values in a logic function, and feeding them to a series of IF, ELSE IF statements. I'm using this with a timer, so I can measure the discrepency. CODE • I GET VALUES FROM TIMER • STRING GOES TO TEXTFIELD 'substr' • NUMBER TRIGGERS TWEENS 'parseInt' • Goes to series of IF and ELSE IF statements

  Read the article

• C++ Templates: implicit conversion, no matching function for call to ctor

  - by noname

  template<class T> class test { public: test() { } test(T& e) { } }; int main() { test<double> d(4.3); return 0; } Compiled using g++ 4.4.1 with the following errors: g++ test.cpp -Wall -o test.exe test.cpp: In function 'int main()': test.cpp:18: error: no matching function for call to 'test<double>::test(double) ' test.cpp:9: note: candidates are: test<T>::test(T&) [with T = double] test.cpp:5: note: test<T>::test() [with T = double] test.cpp:3: note: test<double>::test(const test<double>&) make: *** [test.exe] Error 1 However, this works: double a=1.1; test<double> d(a); Why is this happing? Is it possible that g++ cannot implicitly convert literal expression 1.1 to double? Thanks.

  Read the article

• Replace text in string with delimeters using Regex

  - by user1057735

  I have a string something like, string str = "(50%silicon +20%!(20%Gold + 80%Silver)| + 30%Alumnium)"; I need a Regular Expression which would Replace the contents in between ! and | with an empty string. The result should be (50%silicon +20% + 30%Alumnium). If the string contains something like (with nested delimiters): string str = "(50%silicon +20%!(80%Gold + 80%Silver + 20%!(20%Iron + 80%Silver)|)| + 30%Alumnium)"; The result should be (50%silicon +20% + 30%Alumnium) - ignoring the nested delimiters. I've tried the following Regex, but it doesn't ignore the nesting: Regex.Replace(str , @"!.+?\|", "", RegexOptions.IgnoreCase);

  Read the article

• Create Sum of calculated rows in Microsoft Reporting Services

  - by kd7iwp

  This seems like it should be simple but I can't find anything yet. In Reporting Services I have a table with up to 6 rows that all have calculated values and dynamic visibility. I would like to sum these rows. Basically I have a number of invoice items and want to make a total. I can't change anything on the DB side since my stored procedures are used elsewhere in the system. Each row pulls data from a different dataset as well, so I can't do a sum of the dataset. Can I sum all the rows with a table footer? Similarly to totaling a number of rows in Excel? It seems very redundant to put my visibility expression from each row into my footer row to calculate the sum.

  Read the article

• Problem with nested lambda expressions.

  - by Lehto

  Hey I'm trying to do a nested lambda expression like to following: textLocalizationTable.Where( z => z.SpokenLanguage.Any( x => x.FromCulture == "en-GB") ).ToList(); but i get the error: Member access 'System.String FromCulture' of 'DomainModel.Entities.SpokenLanguage' not legal on type 'System.Data.Linq.EntitySet`1[DomainModel.Entities.SpokenLanguage]. TextLocalization has this relation to spokenlanguage: [Association(OtherKey = "LocalizationID", ThisKey = "LocalizationID", Storage = "_SpokenLanguage")] private EntitySet<SpokenLanguage> _SpokenLanguage = new EntitySet<SpokenLanguage>(); public EntitySet<SpokenLanguage> SpokenLanguage { set { _SpokenLanguage = value; } get { return _SpokenLanguage; } } Any idea what is wrong?

  Read the article

• Getting Unit Tests to work with Komodo IDE for Python

  - by devoured elysium

  I've tried to run the following code on Komodo IDE (for python): import unittest class MathLibraryTests(unittest.TestCase): def test1Plus1Equals2(self): self.assertEqual(1+1, 2) Then, I created a new test plan, pointing to this project(file) directory and tried to run it the test plan. It seems to run but it doesn't seem to find any tests. If I try to run the following code with the "regular" run command (F7) class MathLibraryTests(unittest.TestCase): def testPlus1Equals2(self): self.assertEqual(1+1, 2) if __name__ == "__main__": unittest.main() it works. I get the following output: ---------------------------------------------------------------------- Ran 1 test in 0.000s OK What might I be doing wrong?

  Read the article

• How can I capture multiple matches from the same Perl regex?

  - by Sho Minamimoto

  I'm trying to parse a single string and get multiple chunks of data out from the same string with the same regex conditions. I'm parsing a single HTML doc that is static (For an undisclosed reason, I can't use an HTML parser to do the job.) I have an expression that looks like: $string =~ /\<img\ssrc\="(.*)"/; and I want to get the value of $1. However, in the one string, there are many img tags like this, so I need something like an array returned (@1?) is this possible?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Get latest sql rows based on latest date and per user

  - by Umair

  I have the following table: RowId, UserId, Date 1, 1, 1/1/01 2, 1, 2/1/01 3, 2, 5/1/01 4, 1, 3/1/01 5, 2, 9/1/01 I want to get the latest records based on date and per UserId but as a part of the following query (due to a reason I cannot change this query as this is auto generated by a tool but I can write pass any thing starting with AND...): SELECT RowId, UserId, Date FROM MyTable WHERE 1 = 1 AND ( // everything which needs to be done goes here . . . ) I have tried similar query, but get an error: Only one expression can be specified in the select list when the subquery is not introduced with EXISTS.

  Read the article

• How do I create regex groups for replacement?

  - by resting

  I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

  Read the article

• (type theoretical) How is ([] ==) [] typed in haskell?

  - by Ingo

  It sounds silly, but I can't get it. Why can the expression [] == [] be typed at all? More specifically, which type (in class Eq) is inferred to the type of list elements? In a ghci session, I see the following: Prelude> :t (==[]) (==[]) :: (Eq [a]) => [a] -> Bool But the constraint Eq [a] implies Eq a also, as is shown here: Prelude> (==[]) ([]::[IO ()]) <interactive>:1:1: No instance for (Eq (IO ())) arising from use of `==' at <interactive>:1:1-2 Probable fix: add an instance declaration for (Eq (IO ())) In the definition of `it': it = (== []) ([] :: [IO ()]) Thus, in []==[], the type checker must assume that the list element is some type a that is in class Eq. But which one? The type of [] is just [a], and this is certainly more general than Eq a = [a].

  Read the article

• question about frequency of updating access

  - by I__

  i have a table in an access database this access database is used on a regular basis, basically from 9-5 someone else has a copy of this exact table. sometimes records are added, sometimes deleted, and sometimes data within the records is updated. i need to update the access database table with the offsite table every hour or so. what is the best algorithm of updating the data? there are about 5000 records. would it severely lock up the table for a few seconds every hour? i would like to publicly apologize for my rude comment to david fenton

  Read the article

• Function Pointer from base class

  - by camelord

  Hi there, i need a Function Pointer from a base class. Here is the code: class CActionObjectBase { ... void AddResultStateErrorMessage( const char* pcMessage , ULONG iResultStateCode); ... } CActionObjectCalibration( ): CActionObjectBase() { ... m_Calibration = new CCalibration(&CActionObjectBase::AddResultStateErrorMessage); } class CCalibration { ... CCalibration(void (CActionObjectBase::* AddErrorMessage)(const char*, ULONG )); ... void (CActionObjectBase::* m_AddErrorMessage)(const char*, ULONG ); } Inside CCalibration in a Function occurs the Error. I try to call the Function Pointer like this: if(m_AddErrorMessage) { ... m_AddErrorMessage("bla bla", RSC_FILE_ERROR); } The Problem is, that I cannot compile. The Error Message says something like: error C2064: Expression is no Function, that takes two Arguments. What is wrong? regards camelord

  Read the article

• Perl Regex Multiple Items in Single String

  - by Sho Minamimoto

  I'm trying to parse a single string and get multiple chunks of data out from the same string with the same regex conditions. I'm parsing a single HTML doc that is static (For an undisclosed reason, I can't use an HTML parser to do the job.) I have an expression that looks like $string =~ /\<img\ssrc\="(.*)"/; and I want to get the value of $1. However, in the one string, there are many img tags like this, so I need something like an array returned (@1?) is this possible?

  Read the article

• Check for default value of attribute in XPath

  - by iref

  Hi, i have XML schema: <xsd:complexType name="contactsType"> <xsd:sequence> <xsd:element name="contact" type="contactType" minOccurs="0" maxOccurs="unbounded"/> </xsd:sequence> <xsd:attribute name="visible" type="xsd:boolean" default="true"/> </xsd:complexType> and i want to find all contacts which have @visible=true, //contacts[@visible='true'] but this expression doesn' t return nodes without set @visible like this: <contacts /> so i want to know if there is any function in XPath which returns also default values of attributes Thanks Jan

  Read the article

• Invoking play on a QTMovie causes screensaver to deactivate on Snow Leopard

  - by ressaw

  I'm trying to port a working Leopard screensaver to Snow Leopard but it's deactivating after about half a second. The screensaver seems to deactivate upon invoking play on a QTMovie. And it deactivates both upon -play on the QTMovie object itself, and -play:self on the QTMovieView. If I don't actually call -play on the object, the screensaver does not deactivate and sits still on the first frame of the movie. Setting up the same code in a regular Cocoa Application works fine, and the screensaver also works fine in preview mode in the System Preferences. Any help is greatly appreciated.

  Read the article

• Translate a webpage in PHP

  - by Rob

  I'm looking to translate a webpage in PHP 5 so I can save the translation and make it easily accessible via mydomain.com/lang/fr/category/article.html rather than users having to go through google translate. I've found various easy ways to translate text via CURL, however what i'd really like to be able to do is translate an entire webpage but obviously ignore the tags. The problem is that Google Translate messes up all the HTML tags, class names etc Does anyone know of a php class that can translate an entire webpage whilst ignoring the tags? I'm guessing it may be possible via advanced regular expressions or something like that, but i'm not sure. I can't just curl Google's response as i'll have all the extra JS that they put in. Any ideas?

  Read the article

• Using DateDiff in Entity Framwork on a SQL CE database

  - by deverop

  I have a method which should return a list of anonymous objects with a calculated column like this: var tomorrow = DateTime.Today.AddDays(1); return from t in this.Events where (t.StartTime >= DateTime.Today && t.StartTime < tomorrow && t.EndTime.HasValue) select new { Client = t.Activity.Project.Customer.Name, Project = t.Activity.Project.Name, Task = t.Activity.Task.Name, Rate = t.Activity.Rate.Name, StartTime = t.StartTime, EndTime = t.EndTime.Value, Hours = (System.Data.Objects.SqlClient.SqlFunctions.DateDiff("m", t.StartTime, t.EndTime.Value) / 60), Description = t.Activity.Description }; Unfortunately I get the following error from the DateDiff function: The specified method 'System.Nullable1[System.Int32] DateDiff(System.String, System.Nullable1[System.DateTime], System.Nullable`1[System.DateTime])' on the type 'System.Data.Objects.SqlClient.SqlFunctions' cannot be translated into a LINQ to Entities store expression. Any ideas what I could have done wrong here? EDIT: I also tried the EntityFunctions class mentioned here, but that did not work as well. Minutes = EntityFunctions.DiffMinutes(t.EndTime, t.StartTime),

  Read the article

• Some unclear PHP syntax

  - by serhio

  I am a PHP beginner and saw on the forum this PHP expression: $regex = <<<'END' / ( [\x00-\x7F] # single-byte sequences 0xxxxxxx | [\xC0-\xDF][\x80-\xBF] # double-byte sequences 110xxxxx 10xxxxxx | [\xE0-\xEF][\x80-\xBF]{2} # triple-byte sequences 1110xxxx 10xxxxxx * 2 | [\xF0-\xF7][\x80-\xBF]{3} # quadruple-byte sequence 11110xxx 10xxxxxx * 3 ) | ( [\x80-\xBF] ) # invalid byte in range 10000000 - 10111111 | ( [\xC0-\xFF] ) # invalid byte in range 11000000 - 11111111 /x END; Is this code correct? What do these strange (for me) constructions like <<<, 'END', /, /x, and END; mean? I recieve: Parse error: syntax error, unexpected T_SL in /home/vhosts/mysite.com/public_html/mypage.php on line X Thanks

  Read the article

• Lamp with mod_fastcgi

  - by Jonathan

  Hi! I am building a cgi application, and now I would like it to be like an application that stands and parses each connection, with this, I can have all session variables saved in memory instead of saving them to file(or anyother place) and loading them again on a new connection I am using lamp within a linux vmware but I can't seem to find how to install the module for it to work and what to change in the httpd.conf. I tried to compile the module, but I couldn't because my apache isn't a regular instalation, its a lamp already built one, and it seems that the mod needs the apache directory to be compiled. I saw some coding examples out there, so I guess is not that hard once its runing ok with Apache Can you help me with this please? Thanks, Joe

  Read the article

• Copy constructor demo (crashing... case 2)

  - by AKN

  Please have a glance at this program: class CopyCon { public: char *name; CopyCon() { name = new char[20]; name = "Hai";//_tcscpy(name,"Hai"); } CopyCon(const CopyCon &objCopyCon) { name = new char[_tcslen(objCopyCon.name)+1]; _tcscpy(name,objCopyCon.name); } ~CopyCon() { if( name != NULL ) { delete[] name; name = NULL; } } }; int main() { CopyCon obj1; CopyCon obj2(obj1); cout<<obj1.name<<endl; cout<<obj2.name<<endl; } This program crashes on execution. Error: "Expression: _BLOCK_TYPE_IS_VALID(pHead-nBlockUse)" If I assign "Hai" to name using aasignment operator, its crashing. Where as when I use string func _tcscpy to assign "Hai" to name, its working perfectly. Can some one explain why so?

  Read the article

• Numbering Regex Submatches

  - by gentlylisped

  Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

  Read the article

• Trying to create text boxes dynammically and remove them

  - by fari

  I am using VB.NET vb 2008 . I am trying to create text boxes dynammically and remove them here is the code i have written so far Private Sub setTextBox() Dim num As Integer Dim pos As Integer num = Len(word) temp = String.Copy(word) Dim intcount As Integer remove() GuessBox.Visible = True letters.Visible = True pos = 0 'To create the dynamic text box and add the controls For intcount = 0 To num - 1 Txtdynamic = New TextBox Txtdynamic.Width = 20 Txtdynamic.Visible = True Txtdynamic.MaxLength = 1 Txtdynamic.Location = New Point(pos + 5, 0) pos = pos + 30 'set the font size Txtdynamic.Font = New System.Drawing.Font("Verdana", 8.25!, System.Drawing.FontStyle.Regular, System.Drawing.GraphicsUnit.Point, CType(0, Byte)) Txtdynamic.Name = "txtdynamic_" & intcount & "_mycntrl" Txtdynamic.Enabled = False Txtdynamic.Text = "" Panel1.Controls.Add(Txtdynamic) Next Panel1.Visible = True Controls.Add(Panel1) Controls.Add(GuessBox) Controls.Add(letters) letter = "" letters.Text = "" hang_lable.Text = "" tries = 0 End Sub`enter code here` Function remove() For Each ctrl In Panel1.Controls Panel1.Controls.Remove(ctrl) Next End Function I am able to create the textboxes but only a few of them are removed. by using For Each ctrl In Panel1.Controls it doesn't retrieve all the controls and some ae duplicated as well.

  Read the article

• How to use Zend Cache with SimpleXML objects?

  - by Jeremy Hicks

  I'm trying to cache the user timeline of a Twitter feed using Zend_Service_Twitter which returns its results as a SimpleXML object. Unfortunately the regular serialize functions (which Zend Cache uses) don't play nice with SimpleXMl objects. I found this http://www.mail-archive.com/[email protected]/msg18133.html. So it looks like I'll need to create some kind of custom frontend for Zend Cache to be able to change the serialize function used. Anybody ever done this already or can point me where to look to start?

  Read the article

• Is it possible to force ignore the :hover pseudoclass for iPhone/iPad users?

  - by christophercamps

  I have some css menus on my site that expand with :hover (without js) This works in a semi-broken way on iDevices, for example a tap will activate the :hover rule and expand the menu, but then tapping elsewhere doesn't remove the :hover. Also if there is a link inside the element that is :hover'ed, you have to tap twice to activate the link (first tap triggers :hover, second tap triggers link). I've been able to make things work nicely on iphone by binding the touchstart event. The problem is that sometimes mobile safari still chooses to trigger the :hover rule from the css instead of my touchstart events! I know this is the problem because when I disable all the :hover rules manually in the css, mobile safari works great (but regular browsers obviously don't anymore). Is there a way to dynamically "cancel" :hover rules for certain elements when the user is on mobile safari? I'm using jQuery.

  Read the article

< Previous Page | 223 224 225 226 227 228 229 230 231 232 233 234  | Next Page >