Search Results

Search found 8593 results on 344 pages for 'regular expression'.

Page 226/344 | < Previous Page | 222 223 224 225 226 227 228 229 230 231 232 233  | Next Page >

  • Transforming a string to a valid PDO_MYSQL DSN

    - by Alix Axel
    What is the most concise way to transform a string in the following format: mysql:[/[/]][user[:pass]@]host[:port]/db[/] Into a usuable PDO connection/instance (using the PDO_MYSQL DSN), some possible examples: $conn = new PDO('mysql:host=host;dbname=db'); $conn = new PDO('mysql:host=host;port=3307;dbname=db'); $conn = new PDO('mysql:host=host;port=3307;dbname=db', 'user'); $conn = new PDO('mysql:host=host;port=3307;dbname=db', 'user', 'pass'); I've been trying some regular expressions (preg_[match|split|replace]) but they either don't work or are too complex, my gut tells me this is not the way to go but nothing else comes to my mind. Any suggestions?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • DataGridRow Cells property

    - by Michal Krawiec
    I would like to get to DataGridRow Cells property. It's a table of cells in a current DataGrid. But I cannot get access direct from code nor by Reflection: var x = dataGridRow.GetType().GetProperty("Cells") //returns null Is there any way to get this table? And related question - in Watch window (VS2008) regular properties have an icon of a hand pointing on a sheet of paper. But DataGridRow.Cells has an icon of a hand pointing on a sheet of paper with a little yellow envelope in a left bottom corner - what does it mean? Thanks for replies.

    Read the article

  • C# Threads.Abort()

    - by Betamoo
    If a thread is running a function func1 that calls another function func2 inside it... Then I called thread.Abort() Will this stop func1 only OR func1 and func2 and all the functions func1 has called?? Thanks Edit: Here are more detail: func1 is called in a new thread, it continuously calls func2 on regular basis... func2 begin doing some work only if some array is not null.. it finishes it and return When supervisor wants to save data, it aborts Thread of func1- and then makes array null, saves data, then fill in the array with new one.. and starts Thread with func1 again.. Sometimes exception is raised because array is null in func2.. so func1 abort did not affect func2

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • sharing web user controls across projects.

    - by Kyle
    I've done this using a regular .cs file that just extends System.Web.UI.UserControl and then included the assembly of the project that contains the control into other projects. I've also created .ascx files in one project then copied all ascx files from a specified folder in the properties-Build Events-Pre-build event. Now what I want to do is a combination of those two: I want to be able to use ascx files that I build in one project, in all of my other projects but I want to include them just using assembly references rather than having to copy them to my "secondary" projects as that seems a ghetto way to accomplish what I want to do. It works yes, but it's not very elegant. Can anyone let me know if this even possible, and if so, what the best way to approach this is?

    Read the article

  • Using string.Format for simple things?

    - by Gerrie Schenck
    In my early .Net programming days, I used string.Format() only for complex string concatenations, for example to compile strings as Problem with customer order 234 of date 2/2/2002 and payment id 55543. But now I use string.Format for almost every string concatenation I have to do, also simple ones such as prefixing a string with something. Console.WriteLine(string.Format("\t\t{0}", myString)); Is there any possible overhead on this? Maybe I should use the regular + operator to do these simple operations? What's your opinion on this?

    Read the article

  • Scrapy Could not find spider Error

    - by Nacari
    I have been trying to get a simple spider to run with scrapy, but keep getting the error: Could not find spider for domain:stackexchange.com when I run the code with the expression scrapy-ctl.py crawl stackexchange.com. The spider is as follow: from scrapy.spider import BaseSpider from __future__ import absolute_import class StackExchangeSpider(BaseSpider): domain_name = "stackexchange.com" start_urls = [ "http://www.stackexchange.com/", ] def parse(self, response): filename = response.url.split("/")[-2] open(filename, 'wb').write(response.body) SPIDER = StackExchangeSpider()` Another person posted almost the exact same problem months ago but did not say how they fixed it, http://stackoverflow.com/questions/1806990/scrapy-spider-is-not-working I have been following the turtorial exactly at http://doc.scrapy.org/intro/tutorial.html, and cannot figure out why it is not working.

    Read the article

  • In OpenRasta is it possible to Pattern match multiple key/value pairs?

    - by Scott Littlewood
    Is it possible in OpenRasta to have a Uri pattern that allows for an array of values of the same key to be submitted and mapped to a handler method accepting an array of the query parameters. Example: Return all the contacts named Dave Smith from a collection. HTTP GET /contacts?filterBy=first&filterValue=Dave&filterBy=last&filterValue=Smith With a configuration of: What syntax would be best for the Uri string pattern matching? (Suggestions welcome) ResourceSpace.Has.ResourcesOfType<List<ContactResource>>() .AtUri("/contacts") .And.AtUri("/contacts?filterBy[]={filterBy}[]&filterValue[]={fv}[]") // Option 1 .And.AtUri("/contacts?filterBy={filterBy}[]&fv={fv}[]") // Option 2 Would map to a Handler method of: public object Get(params Filter[] filters) { /* create a Linq Expression based on the filters using dynamic linq query the repository using the Linq */ return Query.All<Contact>().Where(c => c.First == "Dave" && c.Last == "Smith").ToResource() } where Filter is defined by public class Filter { public string FilterBy { get; set; } public string FilterValue { get; set; } }

    Read the article

  • count of distinct acyclic paths from A[a,b] to A[c,d]?

    - by Sorush Rabiee
    I'm writing a sokoban solver for fun and practice, it uses a simple algorithm (something like BFS with a bit of difference). now i want to estimate its running time ( O and omega). but need to know how to calculate count of acyclic paths from a vertex to another in a network. actually I want an expression that calculates count of valid paths, between two vertices of a m*n matrix of vertices. a valid path: visits each vertex 0 or one times. have no circuits for example this is a valid path: but this is not: What is needed is a method to find count of all acyclic paths between the two vertices a and b. comments on solving methods and tricks are welcomed.

    Read the article

  • Multiple Forms on the Same Page with Rails

    - by Eric Koslow
    So I'm building a rails app for high school students and I've hit a problem when it comes to creating users. I want the students to only be able to create accounts if they select their school and type in their school's password correctly. What is the correct / easiest way of doing this? Should I create a gatekeeper to the user#new action that they have to pass first or if their a way that on the same page a student can submit to forms. One would be the regular username, email, password using: form_for @user do ... end But then creating another form for the high-school / high-school password selection. Ideally the controller would be able to get the params of the high-school form, validate those, then go on to create the user from the user params. Is this possible using rails? My setup: Rails 3 and Ruby 1.9.2dev Thank you!

    Read the article

  • Django queries Especial Caracters

    - by Jorge Machado
    Hi, I Working on location from google maps and using django to. My question is: I have a String in request.GET['descricao'] lets say it contains "Via rapida". In my database i have store = "Via Rápida" i'm doing : local = Local.objects.filter(name__icontains=request.GET['descricao']) with that i can get everthing fine like "Via Rapida" but the result that have "Via rápida" never get match in the query (ASCI caracter may be ?) what must i do given a string "Via rapida" match "via rápida" and "via rapida" ? Regular Expressions ? how ? Thanks

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • Getting an odd error, MSSQL Query using `WITH` clause

    - by Aren B
    The following query: WITH CteProductLookup(ProductId, oid) AS ( SELECT p.ProductID, p.oid FROM [dbo].[ME_CatalogProducts] p ) SELECT rel.Name as RelationshipName, pl.ProductId as FromProductId, pl2.ProductId as ToProductId FROM ( [dbo].[ME_CatalogRelationships] rel INNER JOIN CteProductLookup pl ON pl.oid = rel.from_oid ) INNER JOIN CteProductLookup pl2 ON pl2.oid = rel.to_oid WHERE rel.Name = 'BundleItem' AND pl.ProductId = 'MX12345'; Is generating this error: Msg 319, Level 15, State 1, Line 5 Incorrect syntax near the keyword 'with'. If this statement is a common table expression, an xmlnamespaces clause or a change tracking context clause, the previous statement must be terminated with a semicolon. On execution only. There are no errors/warnings in the sql statement in the managment studio. Any ideas?

    Read the article

  • what the true nature of @ in Transct-SQL

    - by Richard77
    Hello, I reading some old ScottGu's blogs on Linq2SQL. Now I'm doing the SPROC part. I'd like to know what's the exact meaning of @variable. See this from ScottGu's Blog ALTER PROCEDURE dbo.GetCustomersDetails ( @customerID nchar(5), @companyName nvarchar(40) output ) AS SELECT @companyName = CompanyName FROM Customers WHERE CustomerID = @customerID SELECT * FROM Orders WHERE CustomerID = @customerID ORDER BY OrderID I'm kind of lost as, so far, I've though of anything preceded by a '@' as a placeholder for user input. But, in the example above, it looks like '@companyName' is used as a regular variable like in C# for instance (SELECT @companyName = ...). But, @companyName is not known yet. So, what the true nature a something preceded by a '@' like above? a vriable? a simple placeholder to accommodate user entered value? Thanks for helping

    Read the article

  • What logic operator to use, as3?

    - by VideoDnd
    What operator or expression can I use that will fire on every number, including zero? I want a logic operator that will fire with ever number it receives. My animations pause at zero. This skips on zero if (numberThing> 0); This skips on 9 if (numberThing>> 0); This jitters 'fires quickly and goes back on count' if (numberThing== 0); EXPLANATION I'm catching split string values in a logic function, and feeding them to a series of IF, ELSE IF statements. I'm using this with a timer, so I can measure the discrepency. CODE • I GET VALUES FROM TIMER • STRING GOES TO TEXTFIELD 'substr' • NUMBER TRIGGERS TWEENS 'parseInt' • Goes to series of IF and ELSE IF statements

    Read the article

  • How do I create regex groups for replacement?

    - by resting
    I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

    Read the article

  • How to use Visual Studio debugger visualizers built against a different framework version?

    - by michielvoo
    I compiled the ExpressionTreeVisualizer project found in the Visual Studio 2010 samples but when I try to use it in a .NET 3.5 project I get the exception below: Could not load file or assembly 'file:///C:\Program Files (x86)\Microsoft\Visual Studio 2010\Common7\Packages\Debugger\Visualizers\ExpressionTreeVisualizer.dll' or one of its dependencies. This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded. The sample project had the TargetFrameworkVersion set to v4.0 and after changing it to v3.5 and building it now works in my project. I changed the source code and project file and rebuilt it so that I now have two expression tree visualizers, one for v3.5 projects and one for v4.0 projects. Is there a better way? Thanks!

    Read the article

  • Scala 2.8: use Java annotation with an array parameter

    - by yournamehere
    I'm trying to implement an JavaEE Session Bean with Scala 2.8. Because it's a Remote Session Bean, i have to annotate it with the following Java Annotation: @Target({ElementType.TYPE}) @Retention(RetentionPolicy.RUNTIME) public @interface Remote { Class[] value() default {}; } I only found this example for scala 2.7. In Scala 2.7, its possible to define the session bean like this: @Remote {val value = Array(classOf[ITest])} class MyEJB ... How can i use this annotation the same way with Scala 2.8? I already tried many different versions, all resulting in "annotation argument needs to be a constant", "illegal start of simple expression". All of these definitions don't work: @Remote{val value = Array(classOf[PersonScalaEJB])} @Remote(val value = Array(classOf[PersonScalaEJB])) @Remote(Array(classOf[PersonScalaEJB]))

    Read the article

  • php regex to remove HTML

    - by Me1000
    Before we start, strip_tags() doesn't work. now, I've got some data that needs to be parsed, the problem is, I need to get rid of all the HTML that has been formated very strangely. the tags look like this: (notice the spaces) < p > blah blah blah < / p > < a href= " link.html " > blah blah blah < /a > All the regexs I've been trying aren't working, and I don't know enough about regex formating to make them work. I don't care about preserving anything inside of the tags, and would prefer to get rid of the text inside a link if I could. Anyone have any idea? (I really need to just sit down and learn regular expressions one day)

    Read the article

  • Convert PDF to PDF/A-1

    - by AZtec
    I know this probably is not strictly a programming-question (well maybe it is, i don't know) but i'm having serious problems trying to convert a regular pdf (with hyperlinks, bookmarks, images, embedded fonts etc.) into a PDF/A-1 format. I get all kinds of errors when i check it with pdfaPilot. How can i prepare a pdf so no problems will occur when i try to convert to PDF/A-1. Most problems can be fixed with pdfaPilot but apparently not all. One of the problems i get is with the XMP Metadata which are "not properly defined". Wat exactly does this mean, and can i do something to prevent this. Another one is: "Syntax problem: Array with more than 8191 elements" (i hope this one is solvable) I hope someone can help me out here, since i'm in a tight spot right now with deadlines that are killing me.

    Read the article

  • building mono from svn - android target

    - by Jeremy Bell
    There were patches made to mono on trunk svn to support android. My understanding is that essentially instead of Koush's system which builds mono using the android NDK build system directly, these patches add support for the android NDK using the regular mono configure.sh process. I'd like to play around with this patch, but not being an expert in the mono build system, I have no idea how to tell it to target the android NDK, or even where to look. I've been able to build mono from SVN using the default target (linux) on Ubuntu, but no documentation on how to target android was given with the patches. Since anyone not submitting or reviewing a patch is generally ignored on the mono mailing list, I figured I'd post the question here.

    Read the article

  • Open C: Directly with `FileStream` without `CreateFile` API

    - by DxCK
    I trying to open C: directly with FileStream without success: new FileStream("C:", FileMode.Open, FileAccess.Read, FileShare.ReadWrite); System.UnauthorizedAccessException was unhandled Message="Access to the path 'C:\' is denied." Source="mscorlib" StackTrace: in System.IO.__Error.WinIOError(Int32 errorCode, String maybeFullPath) in System.IO.FileStream.Init(String path, FileMode mode, FileAccess access, Int32 rights, Boolean useRights, FileShare share, Int32 bufferSize, FileOptions options, SECURITY_ATTRIBUTES secAttrs, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share, Int32 bufferSize, FileOptions options, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share) in ReadingMftNewTest.Program.Main(String[] args) in D:\CS\2008\ReadingMftNewTest\ReadingMftNewTest\Program.cs:line 76 Note that i openning "C:" but the error says "C:\", where did this slash came from? :\ Is there any chance to open C: without using the CreateFile API? I really don't want be depending on WIN32 API because this code should also run on Mono that dont support WIN32 API, but successfully openning devices with regular FileStream (Mono 1 Microsoft 0).

    Read the article

  • NSString: EOL and rangeOfString issues

    - by carloe
    Could someone please tell me if I am missing something here... I am trying to parse individual JSON objects out of a data stream. The data stream is buffered in a regular NSString, and the individual JSON objects are delineated by a EOL marker. if([dataBuffer rangeOfString:@"\n"].location != NSNotFound) { NSString *tmp = [dataBuffer stringByReplacingOccurrencesOfString:@"\n" withString:@"NEWLINE"]; NSLog(@"%@", tmp); } The code above outputs "...}NEWLINE{..." as expected. But if I change the @"\n" in the if-statement above to @"}\n", I get nothing.

    Read the article

  • Using DateDiff in Entity Framwork on a SQL CE database

    - by deverop
    I have a method which should return a list of anonymous objects with a calculated column like this: var tomorrow = DateTime.Today.AddDays(1); return from t in this.Events where (t.StartTime >= DateTime.Today && t.StartTime < tomorrow && t.EndTime.HasValue) select new { Client = t.Activity.Project.Customer.Name, Project = t.Activity.Project.Name, Task = t.Activity.Task.Name, Rate = t.Activity.Rate.Name, StartTime = t.StartTime, EndTime = t.EndTime.Value, Hours = (System.Data.Objects.SqlClient.SqlFunctions.DateDiff("m", t.StartTime, t.EndTime.Value) / 60), Description = t.Activity.Description }; Unfortunately I get the following error from the DateDiff function: The specified method 'System.Nullable1[System.Int32] DateDiff(System.String, System.Nullable1[System.DateTime], System.Nullable`1[System.DateTime])' on the type 'System.Data.Objects.SqlClient.SqlFunctions' cannot be translated into a LINQ to Entities store expression. Any ideas what I could have done wrong here? EDIT: I also tried the EntityFunctions class mentioned here, but that did not work as well. Minutes = EntityFunctions.DiffMinutes(t.EndTime, t.StartTime),

    Read the article

< Previous Page | 222 223 224 225 226 227 228 229 230 231 232 233  | Next Page >