Search Results

Search found 8593 results on 344 pages for 'regular expression'.

Page 229/344 | < Previous Page | 225 226 227 228 229 230 231 232 233 234 235 236  | Next Page >

• Creating a ListView using Category View

  - by Andrew Moore

  I currently have an application which uses a regular ListView with groups to show a bunch of modules. I would like to use a Category view. Category view is the new view introduced in Windows Vista for the Control Panel: Is there a third party control or a way (via API) to create a ListView which mimics the behavior of the Windows 7 Control Panel? Categories with icons and action links. Separate events for Category Click and Action Click. One or two column layout Separators between action links or lines

  Read the article

• How can I remove sensitive data from the debug_backtrace function?

  - by RenderIn

  I am using print_r(debug_backtrace(), true) to retrieve a string representation of the debug backtrace. This works fine, as print_r handles recursion. When I tried to recursively iterate through the debug_backtrace() return array before turning it into a string it ran into recursion and never ended. Is there some simple way I can remove certain sensitive key/value pairs from the backtrace array? Perhaps some way to turn the array to a string using print_r, then back to an array with the recursive locations changed to the string RECURSION, which I could the iterate through. I don't want to execute regular expressions on the string representation if possible.

  Read the article

• How to extract URL parameters from a URL with Ruby or Rails?

  - by Flackou

  Hi, I have some URLs, like http://www.example.com/something?param1=value1&param2=value2&param3=value3, and I would like to extract the parameters from these URLs and get them in a Hash. Obviously, I could use regular expressions, but I was just wondering if there was easier ways to do that with Ruby or Rails. I haven't found anything in the Ruby Module 'URI' but perhaps I missed something. In fact, I need a method that would do that : extract_parameters_from_url("http://www.example.com/something?param1=value1&param2=value2&param3=value3") => {:param1 => 'value1', :param2 => 'value2', :param3 => 'value3'} Would you have some advices? Thanks in advance. Julien

  Read the article

• Testing file existence using NSURL

  - by Peter Hosey

  Snow Leopard introduced many new methods to use NSURL objects to refer to files, not pathnames or Core Services' FSRefs. However, there's one task I can't find a URL-based method for: Testing whether a file exists. I'm looking for a URL-based version of -[NSFileManager fileExistsAtPath:]. Like that method, it should return YES if the URL describes anything, whether it's a regular file, a directory, or anything else. I could attempt to look up various resource values, but none of them are explicitly guaranteed to not exist if the file doesn't, and some of them (e.g., NSURLEffectiveIconKey) could be costly if it does. I could just use NSFileManager's fileExistsAtPath:, but if there's a more modern method, I'd prefer to use that. Is there a simple method or function in Cocoa, CF, or Core Services that's guaranteed/documented to tell me whether a given file (or file-reference) URL refers to a file-system object that exists?

  Read the article

• Forumotion profile customization using jQuery based on URL

  - by Harvengure

  The idea is have a jQuery snippet (I like Jquery...I can understand it better then regular javascript) that will detect that when it has been run on a profile with a url such as "http://customize.forum-motion.com/profile.forum?mode=viewprofile&u=1" (just as an example)...then upon detecting that it is a url of a profile...fetch data from a specific (and most likely hidden) element before wrapping that data in css tags and appending it to the heady of the current document. In short I'm trying to figure out how to make a sort of profile customization system where users can create their own css. The biggest problem I am having so far is figuring out how to make it so that the snippet can figure out what URL its being run on. Is there a function that can do this in jQuery at all?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Regex pattern for searches with include and exclude

  - by alex-kravchenko-zmeyp

  I am working on a Regex pattern for searches that should allow optional '+' sign to include in the search and '-' sign to exclude from the search. For example: +apple orange -peach should search for apples and oranges and not for peaches. Also the pattern should allow for phrases in double quotes mixed with single words, for example: "red apple" -"black grape" +orange - you get the idea, same as most of the internet searches. So I am running 2 regular expressions, first to pick all the negatives, which is simple because '-' is required: (?<=[\-]"?)((?<=")(?<exclude>[^"]+)|(?<exclude>[^\s,\+\-"]+)) And second to pick positives, and it is a little more complex because '+' is optional: ((?<=[\+\s]")(?<include>[^\s"\+\-][^"]+))|(?<include>(?<![\-\w]"?)([\w][^,\s\-\+]+))(?<!") Positive search is where I am having a problem, it works fine when I run it in RegexBuddy but when I try in .Net the pattern picks up second word from negative criteria, for example in -"black grape" it picks up word 'grape' even though it ends with double quote. Any suggestions?

  Read the article

• asp.net databinding string is passed to function but runtime occurs

  - by rod

  Hi All, I'm using a code-behind function (called TestFx) in my binding expression. I'm passing a string and the function accepts a string but I still get a runtime error saying invalid args. But if I change the method to accept an object and inspect the value, "it's a string!" Can someone please explain? -rod ProductDescription: <asp:Label ID="ProductDescriptionLabel" runat="server" Text='<%# TestFx(Eval("ProductDescription")) %>' /> <br />

  Read the article

• Can't enumerate LinQ results with left join

  - by nvtthang

  var itemSet = from item in da.GetList<Models.account>() join file in objFileStorageList on item.account_id equals file.parent_id into objFile from fileItem in objFile.DefaultIfEmpty() where item.company != null && item.company.company_id == 123 orderby item.updatedDate descending select new { Id = item.account_id, RefNo = item.refNo, StartDate = item.StartDate , EndDate = item.EndDate , Comment = item.comment, FileStorageID = fileItem != null ? fileItem.fileStorage_id : -1, Identification = fileItem != null ? fileItem.identifier : null, fileName = fileItem != null ? fileItem.file_nm : null }; It raises error message when I try to enumerate through collection result from Linq query above. LINQ to Entities does not recognize the method 'System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage] DefaultIfEmpty[fileStorage](System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage])' method, and this method cannot be translated into a store expression foreach (var item in itemSet) { string itemRef= item.RefNo; } Please suggest me any solutions. Thanks in advance.

  Read the article

• What is the best possible technology for pulling huge data from 4 remote servers

  - by Habib Ullah Bahar

  Hello, For one of our project, we need to pull huge real time stock data from 4 remote servers across two countries. The trivial process here, check the sources for a regular interval and save the update to database. But as these are real time stock data of more than 1000 companies, I have to pull every second, which isn't good in case of memory, bandwidth I think. Please give me suggestion on which technology/platform [We are flexible here. PHP, Python, Java, PERL - anyone of them will be OK for us] we should choose, it can be achieved easily and with better performance.

  Read the article

• Looping through list items with jquery

  - by Gallen

  I have this block of code listItems = $("#productList").find("li"); for (var li in listItems) { var product = $(li); var productid = product.children(".productId").val(); var productPrice = product.find(".productPrice").val(); var productMSRP = product.find(".productMSRP").val(); totalItemsHidden.val(parseInt(totalItemsHidden.val(), 10) + 1); subtotalHidden.val(parseFloat(subtotalHidden.val()) + parseFloat(productMSRP)); savingsHidden.val(parseFloat(savingsHidden.val()) + parseFloat(productMSRP - productPrice)); totalHidden.val(parseFloat(totalHidden.val()) + parseFloat(productPrice)); } and I'm not getting the desired results - totalItems is coming out as 180+ and the rest all NaN. I suspect its where i use var product = $(li); or perhaps with the expression on the loop itself. Either way - I need to loop through the <li> items in the <ul> labelled #productList

  Read the article

• Editing a BrowserField's History

  - by Woody

  I have a BrowserField in my app, which works great. It intercept NavigationRequests to links on my website which go to external sites, and brings up a new windows to display those in the regular Browser, which also works great. The problem I have is that if a user clicks a link to say "www.google.com", my app opens that up in a new browser, but also logs it into the BrowserHistory. So if they click back, away from google, they arrive back at my app, but then if they hit back again, the BrowserHistory would land them on the same page they were on (Because going back from Google doesn't move back in the history) I've tried to find a way to edit the BrowserField's BrowserHistory, but this doesn't seem possible. Short of creating my own class for logging the browsing history, is there anything I can do? If I didn't do a good job explaining the problem, don't hesitate for clarification. Thanks

  Read the article

• a question on webpage data scraping using Java

  - by Gemma

  Hi there. I am now trying to implement a simple HTML webpage scraper using Java.Now I have a small problem. Suppose I have the following HTML fragment. <div id="sr-h-left" class="sr-comp"> <a class="link-gray-underline" id="compare_header" rel="nofollow" href="javascript:i18nCompareProd('/serv/main/buyer/ProductCompare.jsp?nxtg=41980a1c051f-0942A6ADCF43B802'); " Compare Showing 1 - 30 of 1,439 matches, The data I am interested is the integer 1.439 shown at the bottom.I am just wondering how can I get that integer out of the HTML. I am now considering using a regular expression,and then use the java.util.Pattern to help get the data out,but still not very clear about the process. I would be grateful if you guys could give me some hint or idea on this data scraping. Thanks a lot.

  Read the article

• Using C# and gppg, how would I construct an abstract syntax tree?

  - by Rupert

  Is there a way to do this almost out-of-the-box? I could go and write a big method that would use the collected tokens to figure out which leaves should be put in which branches and in the end populate a TreeNode object, but since gppg already handled everything by using supplied regular expressions, I was wondering if there's an easier way? Even if not, any pointers as to how best to approach the problem of creating an AST would be appreciated. Apologies if I said anything silly, I'm only just beginning to play the compiler game. :)

  Read the article

• Positioning elements outside an Activity on Android

  - by Aleksander Kmetec

  Is there a way to absolutely position an UI element on Android so that it is located outside an Activity? For example: can you create a fullscreen ImageView simply by moving/resizing an ImageView inside an existing regular Activity instead of creating a new fullscreen activity? EDIT: Re-reading my question I see I wasn't very clear about what I'm trying to accomplish. I'd like to temporarily extend an element to cover the notification bar at the top of the screen. I need to create a semitranslucent fullscreen overlay but since translucent activities cannot cover the notification bar I'm trying to find out if it's possible for an element to break out of activity's bounds and resize itself to fill the whole screen, top to bottom.

  Read the article

• Redirect www.example.com/apple to food.example.com/fruits/apple

  - by Senthil

  I want to redirect users from www.example.com/apple to http://food.example.com/fruits/apple Note: This is a hardcoded redirection. Even a mapping if you will. "apple" will not be substituted with anything else. Nothing in the two URLs will change except for the domain of course. So there is no need for a regular expression to match the "apple" or anything else. There is already dozens of RewriteCond and RewriteRule things in the .htaccess file. I do not want them to be affected. This redirection is independent of those. I have access to the .htaccess file at the root of www.example.com and the httpd.conf What code should I put in .htaccess in order to achieve this? Or should I change the httpd.conf?

  Read the article

• Tentative date casting in tsql

  - by Tewr

  I am looking for something like TRYCAST in TSQL or an equivalent method / hack. In my case I am extracting some date data from an xml column. The following query throws "Arithmetic overflow error converting expression to data type datetime." if the piece of data found in the xml cannot be converted to datetime (in this specific case, the date is "0001-01-01" in some cases). Is there a way to detect this exception before it occurs? select [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'datetime') FROM Customers An example of what I am trying to achieve in pseudocode with an imagined tsql function TRYCAST(expr, totype, defaultvalue): select TRYCAST( [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'nvarchar(100)'), datetime, null) FROM Customers

  Read the article

• Is it possible to create thread-safe collections without locks?

  - by Andrey

  This is pure just for interest question, any sort of questions are welcome. So is it possible to create thread-safe collections without any locks? By locks I mean any thread synchronization mechanisms, including Mutex, Semaphore, and even Interlocked, all of them. Is it possible at user level, without calling system functions? Ok, may be implementation is not effective, i am interested in theoretical possibility. If not what is the minimum means to do it? EDIT: Why immutable collections don't work. This of class Stack with methods Add that returns another Stack. Now here is program: Stack stack = new ...; ThreadedMethod() { loop { //Do the loop stack = stack.Add(element); } } this expression stack = stack.Add(element) is not atomic, and you can overwrite new stack from other thread. Thanks, Andrey

  Read the article

• Integrating iCalendar in Moodle

  - by user61255

  Hi all, I am working on a Moodle project and I have downloaded and installed the latest build(1.9) on my system. I'm using this framework for the very first time so presently trying to get familiar with the environment and the documentation. My need is to embed an iCal kinda calendar on Moodle's front page using the PHP iCalendar API. I downloaded the latest version of PHP iCalendar but kinda needed some help figuring things out further. I am trying to build a plug-in sorta thing which allows you to put a custom-built calendar (in place of the regular Moodle calendar) on your Moodle site. Has anyone ever worked with something similar before? Any suggestions?!! Thanks in advance! --eureka

  Read the article

• Delphi component or library to display mathematical expressions

  - by Svein Bringsli

  I'm looking for a simple component that displays mathematical expressions in Delphi. When I started out I thought it would be easy to find something on the net, but it turns out it was harder than anticipated. There are lots and lots of components that will parse mathematical expressions, but few (none?) that will display them. Ideally I would like a component as simple as a TLabel, where I could set the caption to some expression and it would be displayed correctly, but some sort of library that let's me draw expressions to a canvas would also be sufficient for my needs. Update: I'm not talking about plotting graphs of functions or something like that. I want to display (for instance) (X^2+3)/X like this:

  Read the article

• JTable custom cell renderer to create row header

  - by hhj

  Can somebody please explain how I would create row headers? I already have the data and header texts set in the JTable: all I want to know is how I can use a cell renderer to take that first column (i.e. the row header column) and make it look like the column headers (i.e. the first row). Right now its background is white, so it looks like regular data. I want it to appear gray (or non-opaque I guess??). Oh and it should also not be selectable. Thanks.

  Read the article

• Is it possible to use DLR in a .NET 3.5 website project?

  - by Aplato

  I'm trying to evaluate an expression stored in a database i.e. "if (Q1 ==2) {result = 3.1;} elseif (Q1 ==3){result=4.1;} else result = 5.9;" Rather than parsing it myself I'm trying to use the DLR. I'm using version .92 from the Codeplex repository and my solution is a .NET 3.5 website; and I'm having conflicts between the System.Core and Microsoft.Scripting.ExtenstionAttribute .dll's. Error = { Description: "'ExtensionAttribute' is ambiguous in the namespace 'System.Runtime.CompilerServices'.", File: "InternalXmlHelper.vb" } At this time I cannot upgrade to .NET 4.0 and make significant use of the .net 3.5 features (so downgrading is not an option). Any help greatly appreciated.

  Read the article

• ngModel and component with isolated scope

  - by Artem Andreev

  I am creating simple ui-datetime directive. It splits javascript Date object into _date, _hours and _minutes parts. _date uses jquery ui datepicker, _hours and _minutes - number inputs. See example: http://jsfiddle.net/andreev_artem/nWsZp/3/ On github: https://github.com/andreev-artem/angular_experiments/tree/master/ui-datetime As far as I understand - best practice when you create a new component is to use isolated scope. When I tried to use isolated scope - nothing works. ngModel.$viewValue === undefined. When I tried to use new scope (my example, not so good variant imho) - ngModel uses value on newly created scope. Of course I can create directive with isolated scope and work with ngModel value through "=expression" (example). But I think that working with ngModelController is a better practice. My questions: Can I use ngModelController with isolated scope? If it is not possible which solution is better for creating such component?

  Read the article

• Assigning an @Annotation enum a value

  - by h2g2java

  I created enum Restrictions{ none, enumeration, fractionDigits, length, maxExclusive, maxInclusive, maxLength, minExclusive, minInclusive, minLength, pattern, totalDigits, whiteSpace; public Restrictions setValue(int value){ this.value = value; return this; } public int value; } So that I could happily do something like this, which is perfectly legal syntax. Restrictions r1 = Restrictions.maxLength.setValue(64); The reason being is, I am using enum to restrict the type of restriction that could be used, and be able to assign a value to that restriction. However, my actual motivation is to use that restriction in an @annotation. @Retention(RetentionPolicy.RUNTIME) @Target({ElementType.TYPE, ElementType.FIELD, ElementType.METHOD}) public @interface Presentable { Restrictions[] restrictions() default Restrictions.none; } So that, I intended to do this: @Presentable(restrictions=Restrictions.maxLength.setValue(64)) public String userName; to which, the compiler croaks The value for annotation enum attribute must be an enum constant expression. Is there a way to accomplish what I wish to accomplish

  Read the article

• How to use a different assembly name for different configurations?

  - by Mark Ingram

  In Visual Studio 2008 (and others) when creating a .NET or silverlight application if you look at your project properties, it seems like you can only have one assembly name - across all configurations. I would like to compile my application as: MyAppDebug - in debug mode and just MyApp - in release mode Does anyone know if this is possible? Edit: It seems some people are questioning the reasoning behind the question, so I'll explain a little further: I'm working on a Silverlight application which gets automatically uploaded to our test site when I to a "build solution". The trouble is, the test team are now testing the online version, whilst I work on a new one. So, I want to have a url like .\MyApp.html for the regular version that the QA team will test and then .\MyApp.html?version=debug for the current version that I'm working on.

  Read the article

< Previous Page | 225 226 227 228 229 230 231 232 233 234 235 236  | Next Page >