Search Results

Search found 76226 results on 3050 pages for 'google api java client'.

Page 829/3050 | < Previous Page | 825 826 827 828 829 830 831 832 833 834 835 836  | Next Page >

  • C#.NET Socket Programming: Connecting to remote computers.

    - by Gio Borje
    I have a typical server in my end and a friend using a client to connect to my IP/Port and he consistently receives the exception: "A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond {MY_IP}:{MY_PORT}"—You don't need to know my IP. The client and server, however, work fine on the loopback address (127.0.0.1). I also do not have any firewall nor is windows firewall active. Server: static void Main(string[] args) { Console.Title = "Socket Server"; Console.WriteLine("Listening for messages..."); Socket serverSock = new Socket( AddressFamily.InterNetwork, SocketType.Stream, ProtocolType.Tcp); IPAddress serverIP = IPAddress.Any; IPEndPoint serverEP = new IPEndPoint(serverIP, 33367); SocketPermission perm = new SocketPermission(NetworkAccess.Accept, TransportType.Tcp, "98.112.235.18", 33367); serverSock.Bind(serverEP); serverSock.Listen(10); while (true) { Socket connection = serverSock.Accept(); Byte[] serverBuffer = new Byte[8]; String message = String.Empty; while (connection.Available > 0) { int bytes = connection.Receive( serverBuffer, serverBuffer.Length, 0); message += Encoding.UTF8.GetString( serverBuffer, 0, bytes); } Console.WriteLine(message); connection.Close(); } } Client: static void Main(string[] args) { // Design the client a bit Console.Title = "Socket Client"; Console.Write("Enter the IP of the server: "); IPAddress clientIP = IPAddress.Parse(Console.ReadLine()); String message = String.Empty; while (true) { Console.Write("Enter the message to send: "); // The messsage to send message = Console.ReadLine(); IPEndPoint clientEP = new IPEndPoint(clientIP, 33367); // Setup the socket Socket clientSock = new Socket( AddressFamily.InterNetwork, SocketType.Stream, ProtocolType.Tcp); // Attempt to establish a connection to the server Console.Write("Establishing connection to the server... "); try { clientSock.Connect(clientEP); // Send the message clientSock.Send(Encoding.UTF8.GetBytes(message)); clientSock.Shutdown(SocketShutdown.Both); clientSock.Close(); Console.Write("Message sent successfully.\n\n"); } catch (Exception ex) { Console.WriteLine(ex.Message); } } }

    Read the article

  • applet does not load

    - by jcp
    We have a legacy program that was ported from Java 1.3 to Java 1.5. This application involves applets which worked fine before. After porting however, the applet would not load. However there are no errors or exceptions. The app would just try to load it forever. We tried to run it with Java 1.6 and poof! No problems whatsoever. Isn't Java 6 backwards compatible? So how come it would run in that version and not in 1.5? ==== Java Console log for Java 1.5.0_19 basic: Registered modality listener basic: Registered modality listener basic: Registered modality listener liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=1 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=2 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@b0bad7 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Added progress listener: sun.plugin.util.GrayBoxPainter@ba9340 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@1198891 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> basic: Loading <something>.jar from cache basic: No certificate info, this is unsigned JAR file. Left START init() Left END init() Right START init() Control start() Waiting for Left Panel to load... Right START start() network: Connecting socket://<ip address>:14444 with proxy=DIRECT Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... my HostName : <ip address> Thread-19 Check : Thread-19 Check : Monitor : run : start Thread-20 Monitor : Monitor: run() start Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... the last message goes on forever... and now with the working version: ==== Java Console log for Java 1.6.0_15 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1b000e7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1807ca8 network: CleanupThread used 6 us network: CleanupThread used 5 us network: CleanupThread used 6 us cache: Skip blacklist check as cached value is ok. network: Cache entry found [url: <something>.jar, version: null] network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> network: ResponseCode for <something>.jar : 304 network: Encoding for <something>.jar : null network: Disconnect connection to <something>.jar Reading certificates from 11 <something>.jar | <something>.idx network: No certificate info for unsigned JAR file: <something>.jar basic: Applet loaded. basic: Applet loaded. basic: Applet resized and added to parent container basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27768955 us, TotalTime: 28099230 us Right START init() basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27770563 us, TotalTime: 28100838 us Left START init() basic: Applet loaded. basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27779332 us, TotalTime: 28109607 us Left END init() basic: Applet initialized basic: Removed progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Applet made visible And that's it. Still haven't figured out why it works with java6 and not java5. @valli: the object tag was used, not applet @thorbjorn: i tried that already... it just keeps saying loading applet... @aaron: how can i know what exception it is, if there really is one? and yes we have considered that its a java bug but i still havent found what that bug is. i have to submit a report tomorrow and i've scoured the net but came up with nothing as of yet... @all: thank you for your replies

    Read the article

  • o display an image

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • Using only alphanumeric characters(a-z) inside toCharArray

    - by Aaron
    Below you will find me using toCharArray in order to send a string to array. I then MOVE the value of the letter using a for statement... for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } However, when I use shiftCode to move the value such as... a shifted by -1; I get a symbol @. Is there a way to send the string to shiftCode or tell shiftCode to ONLY use letters? I need it to see my text, like "aaron", and when I use the for statement iterate through a-z only and ignore all symbols and numbers. I THINK it is as simple as... letter=codeWord.toCharArray(a,z); But trying different forms of that and googling it didn't give me any results. Perhaps it has to do with regex or something? Below you will find a complete copy of my program; it works exactly how I want it to do; but it iterates through letters and symbols. I also tried finding instructions online for toCharArray but if there exists any arguments I can't locate them. My program... import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Aaron L. Jones * CS219 * AaronJonesProg3 * * This program is designed to - * Work as a Ceasar Cipher */ /** * * Aaron Jones */ public class AaronJonesProg3 { static String codeWord; static int shiftCode; static int i; static char[] letter; /** * @param args the command line arguments */ public static void main(String[] args) throws IOException { // Instantiating that Buffer Class // We are going to use this to read data from the user; in buffer // For performance related reasons BufferedReader reader; // Building the reader variable here // Just a basic input buffer (Holds things for us) reader = new BufferedReader(new InputStreamReader(System.in)); // Java speaks to us here / We get it to query our user System.out.print("Please enter text to encrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); /**************************************************************** **************************************************************** ***************************************************************/ // Java speaks to us here / We get it to query our user System.out.print("Please enter text to decrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); } }

    Read the article

  • Injection of an EJB into a web java class under JBoss 7.1.1

    - by Dobbo
    I am trying to build a website using JBoss 7.1.1 and RESTeasy. I have managed to constructed and deploy and EAR with a both a WAR and an EJB-JAR contained within: voyager-app.ear META-INF/MANIFEST.MF META-INF/application.xml META-INF/jboss-app.xml lib/voyager-lib.jar voyager-adm.war voyager-ejb.jar voyager-web.war So far things are very simple. voyager-adm.war & voyager-lib.jar are empty (just the manifest file) but I know that I'm going to have code for them shortly. There is just one Stateful EJB - HarbourMasterBean (with just a local interface) and a few Database Entity Beans in the EJB jar file: voyager-ejb.jar META-INF/MANIFEST.MF META-INF/persistence.xml com/nutrastat/voyager/db/HarbourMasterBean.class com/nutrastat/voyager/db/HarbourMasterLocal.class com/nutrastat/voyager/db/PortEntity.class com/nutrastat/voyager/db/ShipEntity.class As far as I can tell the EJBs deploy correctly because the database units are created and the log shows that the publication of some HarbourMaster references: java:global/voyager-app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:module/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:global/voyager-app/voyager-ejb/harbour-master java:app/voyager-ejb/harbour-master java:module/harbour-master The problem lies in getting the HarbourMaster EJB injected into my web bean. The reference to it is alway NULL no matter what I try. voyager-web.war META-INF/MANIFEST.MF WEB-INF/web.xml WEB-INF/classes/com/nutrastat/voyager/web/ WEB-INF/classes/com/nutrastat/voyager/web/Ships.class WEB-INF/classes/com/nutrastat/voyager/web/VoyagerApplication.class Ships.java: @Path("fleet") public class Ships { protected transient final Logger log; @EJB private HarbourMasterLocal harbourMaster; public Ships() { log = LoggerFactory.getLogger(getClass()); } @GET @Path("ships") @Produces({"text/plain"}) public String listShips() { if (log.isDebugEnabled()) log.debug("Harbour master value: " + harbourMaster); return "Harbour Master: " + harbourMaster; } } &lt;web-app xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd" version="3.0" &gt; <display-name>Voyager Web Application</display-name> <listener> <listener-class> org.jboss.resteasy.plugins.server.servlet.ResteasyBootstrap </listener-class> </listener> <servlet> <servlet-name>Resteasy</servlet-name> <servlet-class> org.jboss.resteasy.plugins.server.servlet.HttpServletDispatcher </servlet-class> <init-param> <param-name> javax.ws.rs.Application </param-name> <param-value> com.nutrastat.voyager.web.VoyagerApplication </param-value> </init-param> </servlet> <servlet-mapping> <servlet-name>Resteasy</servlet-name> <url-pattern>/*</url-pattern> </servlet-mapping> &lt;/web-app&gt; I have been searching the web for an answer and read a number of places, both on StackOverflow and elsewhere that suggests is can be done, and that the problems lies with configuration. But they post only snippets and I'm never sure if I'm doing things correctly. Many thanks for any help you can provide. Dobbo

    Read the article

  • Watching a variable for changes without polling.

    - by milkfilk
    I'm using a framework called Processing which is basically a Java applet. It has the ability to do key events because Applet can. You can also roll your own callbacks of sorts into the parent. I'm not doing that right now and maybe that's the solution. For now, I'm looking for a more POJO solution. So I wrote some examples to illustrate my question. Please ignore using key events on the command line (console). Certainly this would be a very clean solution but it's not possible on the command line and my actual app isn't a command line app. In fact, a key event would be a good solution for me but I'm trying to understand events and polling beyond just keyboard specific problems. Both these examples flip a boolean. When the boolean flips, I want to fire something once. I could wrap the boolean in an Object so if the Object changes, I could fire an event too. I just don't want to poll with an if() statement unnecessarily. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Example of checking a variable for changes. * Uses dumb if() and polls continuously. */ public class NotAvoidingPolling { public static void main(String[] args) { boolean typedA = false; String input = ""; System.out.println("Type 'a' please."); while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic if (input.equals("a")) { typedA = true; } else { typedA = false; } // problem: this is polling. if (typedA) System.out.println("Typed 'a'."); } } } Running this outputs: Type 'a' please. a Typed 'a'. On some forums people suggested using an Observer. And although this decouples the event handler from class being observed, I still have an if() on a forever loop. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; import java.util.Observable; import java.util.Observer; /* * Example of checking a variable for changes. * This uses an observer to decouple the handler feedback * out of the main() but still is polling. */ public class ObserverStillPolling { boolean typedA = false; public static void main(String[] args) { // this ObserverStillPolling o = new ObserverStillPolling(); final MyEvent myEvent = new MyEvent(o); final MyHandler myHandler = new MyHandler(); myEvent.addObserver(myHandler); // subscribe // watch for event forever Thread thread = new Thread(myEvent); thread.start(); System.out.println("Type 'a' please."); String input = ""; while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic // but it's decoupled now because there's no handler here. if (input.equals("a")) { o.typedA = true; } } } } class MyEvent extends Observable implements Runnable { // boolean typedA; ObserverStillPolling o; public MyEvent(ObserverStillPolling o) { this.o = o; } public void run() { // watch the main forever while (true) { // event fire if (this.o.typedA) { setChanged(); // in reality, you'd pass something more useful notifyObservers("You just typed 'a'."); // reset this.o.typedA = false; } } } } class MyHandler implements Observer { public void update(Observable obj, Object arg) { // handle event if (arg instanceof String) { System.out.println("We received:" + (String) arg); } } } Running this outputs: Type 'a' please. a We received:You just typed 'a'. I'd be ok if the if() was a NOOP on the CPU. But it's really comparing every pass. I see real CPU load. This is as bad as polling. I can maybe throttle it back with a sleep or compare the elapsed time since last update but this is not event driven. It's just less polling. So how can I do this smarter? How can I watch a POJO for changes without polling? In C# there seems to be something interesting called properties. I'm not a C# guy so maybe this isn't as magical as I think. private void SendPropertyChanging(string property) { if (this.PropertyChanging != null) { this.PropertyChanging(this, new PropertyChangingEventArgs(property)); } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Craziest JavaScript behavior I've ever seen

    - by Dan Ray
    And that's saying something. This is based on the Google Maps sample for Directions in the Maps API v3. <html> <head> <meta name="viewport" content="initial-scale=1.0, user-scalable=no"/> <meta http-equiv="content-type" content="text/html; charset=UTF-8"/> <title>Google Directions</title> <script type="text/javascript" src="http://maps.google.com/maps/api/js?sensor=false"></script> <script type="text/javascript"> var directionDisplay; var directionsService = new google.maps.DirectionsService(); var map; function initialize() { directionsDisplay = new google.maps.DirectionsRenderer(); var myOptions = { zoom:7, mapTypeId: google.maps.MapTypeId.ROADMAP } map = new google.maps.Map(document.getElementById("map_canvas"), myOptions); directionsDisplay.setMap(map); directionsDisplay.setPanel(document.getElementById("directionsPanel")); } function render() { var start; if(navigator.geolocation) { navigator.geolocation.getCurrentPosition(function(position) { start = new google.maps.LatLng(position.coords.latitude,position.coords.longitude); }, function() { handleNoGeolocation(browserSupportFlag); }); } else { // Browser doesn't support Geolocation handleNoGeolocation(); } alert("booga booga"); var end = '<?= $_REQUEST['destination'] ?>'; var request = { origin:start, destination:end, travelMode: google.maps.DirectionsTravelMode.DRIVING }; directionsService.route(request, function(response, status) { if (status == google.maps.DirectionsStatus.OK) { directionsDisplay.setDirections(response); } }); } </script> </head> <body style="margin:0px; padding:0px;" onload="initialize()"> <div><div id="map_canvas" style="float:left;width:70%; height:100%"></div> <div id="directionsPanel" style="float:right;width:30%;height 100%"></div> <script type="text/javascript">render();</script> </body> </html> See that "alert('booga booga')" in there? With that in place, this all works fantastic. Comment that out, and var start is undefined when we hit the line to define var request. I discovered this when I removed the alert I put in there to show me the value of var start, and it quit working. If I DO ask it to alert me the value of var start, it tells me it's undefined, BUT it has a valid (and accurate!) value when we define var request a few lines later. I'm suspecting it's a timing issue--like an asynchronous something is having time to complete in the background in the moment it takes me to dismiss the alert. Any thoughts on work-arounds?

    Read the article

  • How do I prevent my form from freezing when it is loading an image from the web at the click of a button?

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • JSF tags not being rendered as HTML

    - by Toto
    I'm following the Java EE firstcup tutorial using Netbeans and Glassfish. When I execute the JSF web tier I've been instructed to code, the browser gets the same JSF markup coded in the .xhtml file, and the tags are not rendered as HTML tags. I know this by using the view source code in my browser. For example, for this code: <html xmlns="http://www.w3.org/1999/xhtml" xmlns:f="http://java.sun.com/jsf/core" xmlns:h="http://java.sun.com/jsf/html"> <h:head> <title>Page title here</title> </h:head> <h:body> <h2> <h:outputText value="#{bundle.WelcomeMessage}" /> </h2> </h:body> </html> The browser should get something like: <html ...> <head> <title>Page title here</title> </head> <body> <h2> the welcome message goes here </h2> </body> </html> Right? Well, my browser is getting jsf code (the first piece of code above) and not the html code (the second piece of code above). It seems to be a configuration problem in netbeans or glassfish but don't know what. Any ideas? This is my web.xml file: <?xml version="1.0" encoding="UTF-8"?> <web-app version="3.0" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd"> <context-param> <param-name>javax.faces.PROJECT_STAGE</param-name> <param-value>Development</param-value> </context-param> <servlet> <servlet-name>Faces Servlet</servlet-name> <servlet-class>javax.faces.webapp.FacesServlet</servlet-class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>Faces Servlet</servlet-name> <url-pattern>/firstcup/*</url-pattern> </servlet-mapping> <session-config> <session-timeout> 30 </session-timeout> </session-config> <welcome-file-list> <welcome-file>greetings.xhtml</welcome-file> </welcome-file-list> </web-app> This is my faces-config.xml file: <?xml version='1.0' encoding='UTF-8'?> <!-- =========== FULL CONFIGURATION FILE ================================== --> <faces-config version="2.0" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-facesconfig_2_0.xsd"> <application> <resource-bundle> <base-name>firstcup.web.WebMessages</base-name> <var>bundle</var> </resource-bundle> <locale-config> <default-locale>en</default-locale> <supported-locale>es</supported-locale> </locale-config> </application> <navigation-rule> <from-view-id>/greetings.xhtml</from-view-id> <navigation-case> <from-outcome>success</from-outcome> <to-view-id>/response.xhtml</to-view-id> </navigation-case> </navigation-rule> </faces-config> Moreover: The url I'm entering in the browser is http://localhost:8081/firstcup/ but I've also tried: http://localhost:8081/firstcup/greetings.xhtml I've checked Glassfish logs and there's no information about not being able to load FacesServlet

    Read the article

  • maven-ear-plugin works if jboss version is 4.2, but not 5. Why ?

    - by NSINGH
    I am using maven to configure maven-ear-plugin. I am getting following exception when I say jboss version is 5 (See below code, under tag). It works if I replace version to 4.2 <build> <finalName>tactical</finalName> <plugins> <plugin> <artifactId>maven-ear-plugin</artifactId> <configuration> <version>5</version> <defaultJavaBundleDir>lib</defaultJavaBundleDir> <jboss> <version>5</version> <loader-repository>seam.jboss.org:loader=tactical</loader-repository> </jboss> <modules> <ejbModule> <groupId>${project.groupId}</groupId> <artifactId>tactical-jar</artifactId> </ejbModule> </modules> </configuration> </plugin> </plugins> </build> Why it works fine for jboss 4.2 but not for 5. What ?? I get the following exception: [INFO] Failed to initialize JBoss configuration Embedded error: Invalid JBoss configuration, version[5] is not supported. [INFO] ------------------------------------------------------------------------ [INFO] Trace org.apache.maven.lifecycle.LifecycleExecutionException: Failed to initialize JBoss configuration at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:583) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalWithLifecycle(DefaultLifecycleExecutor.java:49 9) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoal(DefaultLifecycleExecutor.java:478) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalAndHandleFailures(DefaultLifecycleExecutor.jav a:330) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeTaskSegments(DefaultLifecycleExecutor.java:291) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.execute(DefaultLifecycleExecutor.java:142) at org.apache.maven.DefaultMaven.doExecute(DefaultMaven.java:336) at org.apache.maven.DefaultMaven.execute(DefaultMaven.java:129) at org.apache.maven.cli.MavenCli.main(MavenCli.java:287) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.codehaus.classworlds.Launcher.launchEnhanced(Launcher.java:315) at org.codehaus.classworlds.Launcher.launch(Launcher.java:255) at org.codehaus.classworlds.Launcher.mainWithExitCode(Launcher.java:430) at org.codehaus.classworlds.Launcher.main(Launcher.java:375) Caused by: org.apache.maven.plugin.MojoExecutionException: Failed to initialize JBoss configuration at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:159) at org.apache.maven.plugin.ear.GenerateApplicationXmlMojo.execute(GenerateApplicationXmlMojo.java:96) at org.apache.maven.plugin.DefaultPluginManager.executeMojo(DefaultPluginManager.java:451) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:558) ... 16 more Caused by: org.apache.maven.plugin.ear.EarPluginException: Invalid JBoss configuration, version[5] is not supported. at org.apache.maven.plugin.ear.JbossConfiguration.(JbossConfiguration.java:95) at org.apache.maven.plugin.ear.AbstractEarMojo.initializeJbossConfiguration(AbstractEarMojo.java:296) at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:155) ... 19 more [INFO] ------------------------------------------------------------------------ [INFO] Total time: 2 seconds Any idea. Thanks

    Read the article

  • Error showing is NullPointerException [duplicate]

    - by user3659612
    This question already has an answer here: How to check a string against null in java? 11 answers I was trying to code a wifi scanner which does 20 scans but it shows NullPointerException at if(bssid[j].equals(null)){ My code is slightly huge package com.example.scanner; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStreamWriter; import java.text.SimpleDateFormat; import java.util.Date; import java.util.List; import android.annotation.SuppressLint; import android.content.BroadcastReceiver; import android.content.Context; import android.content.Intent; import android.content.IntentFilter; import android.net.wifi.ScanResult; import android.net.wifi.WifiInfo; import android.net.wifi.WifiManager; import android.os.Bundle; import android.os.Environment; import android.support.v7.app.ActionBarActivity; import android.view.Menu; import android.view.View; import android.widget.ArrayAdapter; import android.widget.Button; import android.widget.ListView; import android.widget.Toast; public class MainActivity extends ActionBarActivity { WifiManager wifi; WifiScanReceiver wifireciever; WifiInfo info; Button scan, save; List<ScanResult> wifilist; ListView list; String wifis[]; String name; String[] ssid = new String[100]; String[] bssid = new String[100]; int[] lvl = new int[100]; int[] count = new int[100]; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.fragment_main); list=(ListView)findViewById(R.id.listView1); scan=(Button)findViewById(R.id.button1); save=(Button)findViewById(R.id.button2); scan.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub wifi=(WifiManager)getSystemService(Context.WIFI_SERVICE); if (wifi.isWifiEnabled()==false){ wifi.setWifiEnabled(true); } wifireciever = new WifiScanReceiver(); for (int i=0;i<20;i++){ registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); wifi.startScan(); if (i==19){ Toast.makeText(getBaseContext(), "Scan Finish", Toast.LENGTH_LONG).show(); } } } }); save.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub savedata(); } }); } protected void savedata() { // TODO Auto-generated method stub try { File sdcard = Environment.getExternalStorageDirectory(); File directory = new File(sdcard.getAbsolutePath() + "/WIFI_RESULT"); directory.mkdirs(); name = new SimpleDateFormat("yyyy-MM-dd HH mm ss").format(new Date()); File file = new File(directory,name + "wifi_data.txt"); FileOutputStream fou = new FileOutputStream(file); OutputStreamWriter osw = new OutputStreamWriter(fou); try { for (int i =0; i < list.getCount(); i++){ osw.append(list.getItemAtPosition(i).toString()); } osw.flush(); osw.close(); Toast.makeText(getBaseContext(), "Saved", Toast.LENGTH_LONG).show(); } catch (IOException e){ e.printStackTrace(); } } catch (FileNotFoundException e){ e.printStackTrace(); } } class WifiScanReceiver extends BroadcastReceiver { @SuppressLint("UseValueOf") public void onReceive(Context c, Intent intent) { int a =0; wifi.startScan(); List<ScanResult> wifilist = wifi.getScanResults(); if (a<wifilist.size()){ a=wifilist.size(); } for(int j=0;j<wifilist.size();j++){ if(bssid[j].equals(null)){ ssid[j] = wifilist.get(j).SSID.toString(); bssid[j] = wifilist.get(j).BSSID.toString(); lvl[j] = wifilist.get(j).level; count[j]++; } else if (bssid[j].equals(wifilist.get(j).BSSID.toString())){ lvl[j] = lvl[j] + wifilist.get(j).level; count[j]++; } } wifis = new String[a]; for (int i =0; i<a; i++){ wifis[i] = ("\n" + ssid[i] + "\n AP Address" + bssid[i] + "\n Signal Strength:" + lvl[i]/count[i]).toString(); } list.setAdapter(new ArrayAdapter<String>(getApplicationContext(), android.R.layout.simple_list_item_1,wifis)); } } protected void onDestroy() { unregisterReceiver(wifireciever); super.onPause(); } protected void onResume() { registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); super.onResume(); } @Override public boolean onCreateOptionsMenu(Menu menu) { // Inflate the menu; this adds items to the action bar if it is present. getMenuInflater().inflate(R.menu.main, menu); return true; } } NullPointerException at that point mean my array bssid isn't initialize. So I just want to know how to initialize it in main activity so that I can use that string bssid anywhere.

    Read the article

  • Google TV Gets Bad Reception. Can Media Center Pull in the Signal?

    - by andrewbrust
    The news hit Monday morning that Google has decided to delay the release of its Google TV platform, and has asked its OEMs to delay any products that embed the software.  Coming just about two weeks prior to the 2011 Consumer Electronics Show (CES), Google’s timing is about the worst imaginable.  CES is where the platform should have had its coming out party, especially given all the anticipation that has built up since its initial announcement came 7 months ago. At last year’s CES, it seemed every consumer electronics company had fashioned its own software stack for Internet-based video programming and applications/widgets on its TVs, optical disc players and set top boxes.  In one case, I even saw two platforms on a single TV set (one provided by Yahoo and the other one native to the TV set). The whole point of Google TV was to solve this problem and offer a standard, embeddable platform.  But that won’t be happening, at least not for a while.  Google seems unable to get it together, and more proprietary approaches, like Apple TV, don’t seem to be setting the world of TV-Internet convergence on fire, either. It seems to me, that when it comes to building a “TV operating system,” Windows Media Center is still the best of a bad bunch.  But it won’t stay so for much longer without some changes.  Will Redmond pick up the ball that Google has fumbled?  I’m skeptical, but hopeful.  Regardless, here are some steps that could help Microsoft make the most of Google’s faux pas: Introduce a new Media Center version that uses XBox 360, rather than Windows 7 (or 8), as the platform.  TV platforms should be appliance-like, not PC-like.  Combine that notion with the runaway sales numbers for Xbox 360 Kinect, and the mass appeal it has delivered for Xbox, and the switch form Windows makes even more sense. As I have pointed out before, Microsoft’s Xbox implementation of its Mediaroom platform (announced and demoed at last year’s CES) gets Redmond 80% of the way toward this goal.  Nothing stops Microsoft from going the other 20%, other than its own apathy, which I hope has dissipated. Reverse the decision to remove Drive Extender technology from Windows Home Server (WHS), and create deep integration between WHS and Media Center.  I have suggested this previously as well, but the recent announcement that Drive Extender would be dropped from WHS 2.0 creates the need for me to a) join the chorus of people urging Microsoft to reconsider and b) reiterate the importance of Media Center-WHS integration in the context of a Google compete scenario. Enable Windows Phone 7 (WP7) as a Media Center client.  This would tighten the integration loop already established between WP7, Xbox and Zune.  But it would also counter Echostar/DISH Network/Sling Media, strike a blow against Google/Android (and even Apple/iOS) and could be the final strike against TiVO. Bring the WP7 user interface to Media Center and Kinect-enable it.  This would further the integration discussed above and would be appropriate recognition of WP7’s Metro UI having been built on the heritage of the original Media Center itself.  And being able to run your DVR even if you can’t find the remote (or can’t see its buttons in the dark) could be a nifty gimmick. Microsoft can do this but its consumer-oriented organization, responsible for Xbox, Zune and WP7, has to take the reins here, or none of this will likely work.  There’s a significant chance that won’t happen, but I won’t let that stop me from hoping that it does and insisting that it must.  Honestly, this fight is Microsoft’s to lose.

    Read the article

  • Download YouTube Videos the Easy Way

    - by Trevor Bekolay
    You can’t be online all the time, and despite the majority of YouTube videos being nut-shots and Lady Gaga parodies, there is a lot of great content that you might want to download and watch offline. There are some programs and browser extensions to do this, but we’ve found that the easiest and quickest method is a bookmarklet that was originally posted on the Google Operating System blog (it’s since been removed). It will let you download standard quality and high-definition movies as MP4 files. Also, because it’s a bookmarklet, it will work on any modern web browser, and on any operating system! Installing the bookmarket is easy – just drag and drop the Get YouTube video link below to the bookmarks bar of your browser of choice. If you’ve hidden the bookmark bar, in most browsers you can right-click on the link and save it to your bookmarks. Get YouTube video   With the bookmarklet available in your browser, go to the YouTube video that you’d like to download. Click on the Get YouTube video link in your bookmarks bar, or in the bookmarks menu, wherever you saved it earlier. You will notice some new links appear below the description of the video. If you download the standard definition file, it will save as “video.mp4” by default. However, if you download the high definition file, it will save with the same name as the title of the video. There are many methods of downloading YouTube videos…but we think this is the easiest and quickest method. You don’t have to install anything or use up resources, but you can still get a link to download an MP4 with one click. Do you use a different method to download Youtube videos? Let us know about it in the comments! javascript:(function(){if(document.getElementById(’download-youtube-video’))return;var args=null,video_title=null,video_id=null,video_hash=null;var download_code=new Array();var fmt_labels={‘18′:’standard%20MP4′,’22′:’HD%20720p’,'37′:’HD%201080p’};try{args=yt.getConfig(’SWF_ARGS’);video_title=yt.getConfig(’VIDEO_TITLE’)}catch(e){}if(args){var fmt_url_map=unescape(args['fmt_url_map']);if(fmt_url_map==”)return;video_id=args['video_id'];video_hash=args['t'];video_title=video_title.replace(/[%22\'\?\\\/\:\*%3C%3E]/g,”);var fmt=new Array();var formats=fmt_url_map.split(’,');var format;for(var i=0;i%3Cformats.length;i++){var format_elems=formats[i].split(’|');fmt[format_elems[0]]=unescape(format_elems[1])}for(format in fmt_labels){if(fmt[format]!=null){download_code.push(’%3Ca%20href=\”+(fmt[format]+’&title=’+video_title)+’\'%3E’+fmt_labels[format]+’%3C/a%3E’)}elseif(format==’18′){download_code.push(’%3Ca%20href=\’http://www.youtube.com/get_video?fmt=18&video_id=’+video_id+’&t=’+video_hash+’\'%3E’+fmt_labels[format]+’%3C/a%3E’)}}}if(video_id==null||video_hash==null)return;var div_embed=document.getElementById(’watch-embed-div’);if(div_embed){var div_download=document.createElement(’div’);div_download.innerHTML=’%3Cbr%20/%3E%3Cspan%20id=\’download-youtube-video\’%3EDownload:%20′+download_code.join(’%20|%20′)+’%3C/span%3E’;div_embed.appendChild(div_download)}})() Similar Articles Productive Geek Tips Watch YouTube Videos in Cinema Style in FirefoxDownload YouTube Videos with Cheetah YouTube DownloaderStop YouTube Videos from Automatically Playing in FirefoxImprove YouTube Video Viewing in Google ChromeConvert YouTube Videos to MP3 with YouTube Downloader TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips Revo Uninstaller Pro Registry Mechanic 9 for Windows PC Tools Internet Security Suite 2010 PCmover Professional 15 Great Illustrations by Chow Hon Lam Easily Sync Files & Folders with Friends & Family Amazon Free Kindle for PC Download Stretch popurls.com with a Stylish Script (Firefox) OldTvShows.org – Find episodes of Hitchcock, Soaps, Game Shows and more Download Microsoft Office Help tab

    Read the article

  • 6 Prominent Features of New GMail User Interface

    - by Gopinath
    GMail’s user interface has got a big make over today and the new user interface is available to everyone. We can switch to the new user interface by click on “Switch to the new look” link available at the bottom right of GMail (If you are on IE 6 or similar type of bad browsers, you will not see the option!). I switched to the new user interface as soon I noticed the link and played with it for sometime. In this post I want to share the prominent features of all new GMail interface. 1. All New Conversations Interface GMail’s threaded conversations is a game changing feature when it was first introduced by Google. For  a long time we have not seen much updates to the threaded conversation views. In the new GMail interface, threaded conversation sports a great new look – conversations are always visible in a horizontal fashion as opposed to stack interface of earlier version. When you open a conversation, you get a quick glance of individual thread without expanding the thread. Readability is improved a lot now.  Check image after the break 2. Sender Profile Photos In Email Threads Did you observe the above screenshot of conversations view? It has profile images of the participants in the thread. Identifying person of a thread is much more easy. 3. Advanced Search Box Search is the heart of Google’s business and it’s their flagship technology. GMail’s search interface is enhanced to let you quickly find the required e-mails. Also you can create mail filters from the search box without leaving the screen or opening up a new popup. 4. Gmail Automatically Resizing To Fit Multiple Devices There is no doubt that this is post PC era where people started using more of tablets and big screen smartphones than ever. The new user interface of GMail automatically resizes itself to fit the size of screen seamlessly. 5. HD Images For Your Themes, Sourced from iStockphoto Are you bored with minimalistic GMail interface and the few flashy themes? Here comes GMail HD themes backed by stock photographs sourced from iStockPhoto website. If you have a widescreen HD monitor then decorate your inbox with beautiful themes. 6. Resize Labels & Chat Panels Now you got a splitter between Labels & Chat panel that lets resize their height as you prefer. Also Label panel auto expands its height when you mouse over to show you hidden labels if any. Video – overview of new GMail features This article titled,6 Prominent Features of New GMail User Interface, was originally published at Tech Dreams. Grab our rss feed or fan us on Facebook to get updates from us.

    Read the article

  • Chrome Web Browser Messages: Some Observations

    - by ultan o'broin
    I'm always on the lookout for how different apps handle errors and what kind of messages are shown (I probably need to get out more), I use this 'research' to reflect on our own application error messages patterns and guidelines and how we might make things better for our users in future. Users are influenced by all sorts of things, but their everyday experiences of technology, and especially what they encounter on the internet, increasingly sets their expectations for the enterprise user experience too. I recently came across a couple of examples from Google's Chrome web browser that got me thinking. In the first case, we have a Chrome error about not being able to find a web page. I like how simple, straightforward messaging language is used along with an optional ability to explore things a bit further--for those users who want to. The 'more information' option shows the error encountered by the browser (or 'original' error) in technical terms, along with an error number. Contrasting the two messages about essentially the same problem reveals what's useful to users and what's not. Everyone can use the first message, but the technical version of the message has to be explicitly disclosed for any more advanced user to pursue further. More technical users might search for a resolution, using that Error 324 number, but I imagine most users who see the message will try again later or check their URL again. Seems reasonable that such an approach be adopted in the enterprise space too, right? Maybe. Generally, end users don't go searching for solutions based on those error numbers, and help desk folks generally prefer they don't do so. That's because of the more critical nature of enterprise data or the fact that end users may not have the necessary privileges to make any fixes anyway. What might be more useful here is a link to a trusted source of additional help provided by the help desk or reputable community instead. This takes me on to the second case, this time more closely related to the language used in messaging situations. Here, I first noticed by the using of the (s) approach to convey possibilities of there being one or more pages at the heart of the problem. This approach is a no-no in Oracle style terms (the plural would be used) and it can create translation issues (though it is not a show-stopper). I think Google could have gone with the plural too. However, of more interest is the use of the verb "kill", shown in the message text and as an action button label. For many writers, words like "kill" and "abort" are to be avoided as they can give offense. I am not so sure about that judgment, as really their use cannot be separated from the context. Certainly, for more technical users, they're fine and have been in use for years, so I see no reason to avoid these terms if the audience has accepted them. Most end users too, I think would find the idea of "kill" usable and may even use the term in every day speech. Others might disagree--Apple uses a concept of Force Quit, for example. Ultimately, the only way to really know how to proceed is to research these matter by asking users of differing roles and expertise to perform some tasks, encounter these messages and then make recommendations based on those findings for our designs. Something to do in 2011!

    Read the article

  • Why would Copying a Large Image to the Clipboard Freeze a Computer?

    - by Akemi Iwaya
    Sometimes, something really odd happens when using our computers that makes no sense at all…such as copying a simple image to the clipboard and the computer freezing up because of it. An image is an image, right? Today’s SuperUser post has the answer to a puzzled reader’s dilemna. Today’s Question & Answer session comes to us courtesy of SuperUser—a subdivision of Stack Exchange, a community-driven grouping of Q&A web sites. Original image courtesy of Wikimedia. The Question SuperUser reader Joban Dhillon wants to know why copying an image to the clipboard on his computer freezes it up: I was messing around with some height map images and found this one: (http://upload.wikimedia.org/wikipedia/commons/1/15/Srtm_ramp2.world.21600×10800.jpg) The image is 21,600*10,800 pixels in size. When I right click and select “Copy Image” in my browser (I am using Google Chrome), it slows down my computer until it freezes. After that I must restart. I am curious about why this happens. I presume it is the size of the image, although it is only about 6 MB when saved to my computer. I am also using Windows 8.1 Why would a simple image freeze Joban’s computer up after copying it to the clipboard? The Answer SuperUser contributor Mokubai has the answer for us: “Copy Image” is copying the raw image data, rather than the image file itself, to your clipboard. The raw image data will be 21,600 x 10,800 x 3 (24 bit image) = 699,840,000 bytes of data. That is approximately 700 MB of data your browser is trying to copy to the clipboard. JPEG compresses the raw data using a lossy algorithm and can get pretty good compression. Hence the compressed file is only 6 MB. The reason it makes your computer slow is that it is probably filling your memory up with at least the 700 MB of image data that your browser is using to show you the image, another 700 MB (along with whatever overhead the clipboard incurs) to store it on the clipboard, and a not insignificant amount of processing power to convert the image into a format that can be stored on the clipboard. Chances are that if you have less than 4 GB of physical RAM, then those copies of the image data are forcing your computer to page memory out to the swap file in an attempt to fulfil both memory demands at the same time. This will cause programs and disk access to be sluggish as they use the disk and try to use the data that may have just been paged out. In short: Do not use the clipboard for huge images unless you have a lot of memory and a bit of time to spare. Like pretty graphs? This is what happens when I load that image in Google Chrome, then copy it to the clipboard on my machine with 12 GB of RAM: It starts off at the lower point using 2.8 GB of RAM, loading the image punches it up to 3.6 GB (approximately the 700 MB), then copying it to the clipboard spikes way up there at 6.3 GB of RAM before settling back down at the 4.5-ish you would expect to see for a program and two copies of a rather large image. That is a whopping 3.7 GB of image data being worked on at the peak, which is probably the initial image, a reserved quantity for the clipboard, and perhaps a couple of conversion buffers. That is enough to bring any machine with less than 8 GB of RAM to its knees. Strangely, doing the same thing in Firefox just copies the image file rather than the image data (without the scary memory surge). Have something to add to the explanation? Sound off in the comments. Want to read more answers from other tech-savvy Stack Exchange users? Check out the full discussion thread here.

    Read the article

  • Non-blocking I/O using Servlet 3.1: Scalable applications using Java EE 7 (TOTD #188)

    - by arungupta
    Servlet 3.0 allowed asynchronous request processing but only traditional I/O was permitted. This can restrict scalability of your applications. In a typical application, ServletInputStream is read in a while loop. public class TestServlet extends HttpServlet {    protected void doGet(HttpServletRequest request, HttpServletResponse response)         throws IOException, ServletException {     ServletInputStream input = request.getInputStream();       byte[] b = new byte[1024];       int len = -1;       while ((len = input.read(b)) != -1) {          . . .        }   }} If the incoming data is blocking or streamed slower than the server can read then the server thread is waiting for that data. The same can happen if the data is written to ServletOutputStream. This is resolved in Servet 3.1 (JSR 340, to be released as part Java EE 7) by adding event listeners - ReadListener and WriteListener interfaces. These are then registered using ServletInputStream.setReadListener and ServletOutputStream.setWriteListener. The listeners have callback methods that are invoked when the content is available to be read or can be written without blocking. The updated doGet in our case will look like: AsyncContext context = request.startAsync();ServletInputStream input = request.getInputStream();input.setReadListener(new MyReadListener(input, context)); Invoking setXXXListener methods indicate that non-blocking I/O is used instead of the traditional I/O. At most one ReadListener can be registered on ServletIntputStream and similarly at most one WriteListener can be registered on ServletOutputStream. ServletInputStream.isReady and ServletInputStream.isFinished are new methods to check the status of non-blocking I/O read. ServletOutputStream.canWrite is a new method to check if data can be written without blocking.  MyReadListener implementation looks like: @Overridepublic void onDataAvailable() { try { StringBuilder sb = new StringBuilder(); int len = -1; byte b[] = new byte[1024]; while (input.isReady() && (len = input.read(b)) != -1) { String data = new String(b, 0, len); System.out.println("--> " + data); } } catch (IOException ex) { Logger.getLogger(MyReadListener.class.getName()).log(Level.SEVERE, null, ex); }}@Overridepublic void onAllDataRead() { System.out.println("onAllDataRead"); context.complete();}@Overridepublic void onError(Throwable t) { t.printStackTrace(); context.complete();} This implementation has three callbacks: onDataAvailable callback method is called whenever data can be read without blocking onAllDataRead callback method is invoked data for the current request is completely read. onError callback is invoked if there is an error processing the request. Notice, context.complete() is called in onAllDataRead and onError to signal the completion of data read. For now, the first chunk of available data need to be read in the doGet or service method of the Servlet. Rest of the data can be read in a non-blocking way using ReadListener after that. This is going to get cleaned up where all data read can happen in ReadListener only. The sample explained above can be downloaded from here and works with GlassFish 4.0 build 64 and onwards. The slides and a complete re-run of What's new in Servlet 3.1: An Overview session at JavaOne is available here. Here are some more references for you: Java EE 7 Specification Status Servlet Specification Project JSR Expert Group Discussion Archive Servlet 3.1 Javadocs

    Read the article

  • NetBeans Podcast 69

    - by TinuA
    Podcast Guests: Terrence Barr, Simon Ritter, Jaroslav Tulach (It's an all-Oracle lineup!) Download mp3: 47 Minutes – 39.5 mb Subscribe on iTunes NetBeans Community News with Geertjan and Tinu If you missed the first two Java Virtual Developer Day events in early May, there's still one more LIVE training left on May 28th. Sign up here to participate live in the APAC time zone or watch later ON DEMAND. Video: Get started with Vaadin development using NetBeans IDE NetBeans IDE was at JavaCro 2014 and at Hippo Get-together 2014 Another great lineup is in the works for NetBeans Day at JavaOne 2014. More details coming soon! NetBeans' Facebook page is almost at 40,000 Likes! Help us crack that milestone in the next few weeks! Other great ways to stay updated about NetBeans? Twitter and Google+. 09:28 / Terrence Barr - What to Know about Java Embedded Terrence Barr, a Senior Technologist and Principal Product Manager for Embedded and Mobile technologies at Oracle, discusses new features of the Java SE Embedded and Java ME Embedded platforms, and sheds some light on the differences between them and what they have to offer to developers. Learn more about Java SE Embedded Tutorial: Using Oracle Java SE Embedded Support in NetBeans IDE Learn more about Java ME Embedded Video: NetBeans IDE Support for Java ME 8 Video: Installing and Using Java ME SDK 8.0 Plugins in NetBeans IDE Follow Terrence Barr to keep up with news in the Embedded space: Blog and Twitter 26:02 / Simon Ritter - A Massive Serving of Raspberry Pi Oracle's Raspberry Pi virtual course is back by popular demand! Simon Ritter, the head of Oracle's Java Technology Evangelism team, chats about the second run of the free Java Embedded course (starting May 30th), what participants can expect to learn, NetBeans' support for Java ME development, and other Java trainings coming to a desktop, laptop or user group near you. Sign up for the Oracle MOOC: Develop Java Embedded Applications Using Raspberry Pi Find out when Simon Ritter and the Java Evangelism team are coming to a Java event or JUG in your area--follow them on Twitter: Simon Ritter Angela Caicedo Steven Chin Jim Weaver 36:58 / Jaroslav Tulach - A Perfect Translation Jaroslav Tulach returns to the NetBeans podcast with tales about the Japanese translation of the Practical API Design book, which he contends surpasses all previous translations, including the English edition! Order "Practical API Design" (Japanese Version)  Find out why the Japanese translation is the best edition yet *Have ideas for NetBeans Podcast topics? Send them to ">nbpodcast at netbeans dot org. *Subscribe to the official NetBeans page on Facebook! Check us out as well on Twitter, YouTube, and Google+.

    Read the article

  • The Developer's Conference Florianópolis, Brazil

    - by Tori Wieldt
    by guest blogger Yara Senger With over 2900 developers in person and another 2000 online, The Developer's Conference (TDC) in Florianópolis, Brazil, reminds us that Java is BIG in Brazil. The conference included 20 different tracks, and Java was the most popular track. Java was also a big part of the talks in the IoT, Cloud and BigData tracks. Here's my overview (in Brazilian Portguese): Several JUGs were involved in TDC Florianópolis, serving as track leads, speakers and all-around heros, including SouJava SouJava Campinas GUJava Santa Catarina JUG Vale JUG Maringá Java Bahia GOJava (Goinia) JUG Rio do Sul RS Jug (Rio Grande do Sul) and I thank them for their support and commitment. It is a vibrant and fun community! We saw that the IoT space is maturing rapidly. There are already some related to embedded in the region.  Java Evangelist Bruno Borges and Marco Antonio Maciel gave a view popular talk "Java: Tweet for Beer!" They demonstrated how to make a beer tap controlled by Java and connected to the Internet, using a visual application JavaFX with Java SE 8, running on a Rasperry Pi. Of course, they had to test the application quite throughly.   We Brazilians are training the next generation of Java developers. TDC4Kids was as big success. We made a tour with the kids in all booths and almost everybody talked about Java. Java in government managment (Betha), Java on the 2048  (Oracle), Java on the popcorn machine and Java training (Globalcode & V.Office) and of course: Java & Minecraft! OTN's Pablo Ciccarello was there to support the community.  He did several video interviews with JUG leaders and speakers (mine included). You can watch more videos on his TDC Florianópolis playlist.  Thank you, Oracle and OTN for all your support. We interacted with thousands of Java developers at The Developer's Conference Florianópolis. If you want to join us, we are planning two more conferences this year: The Developer's Conference São Paulo, July  The Developer's Conference Porto Alegre, October 

    Read the article

  • Cookies Audit help

    - by Gino
    Someone can explain to me what is the purpose of these cookies? I'm doing a cookies audit and I didn't find anything on the web Domain: google.com(google maps), Name: NID Domain: google.com(google maps), Name: SNID Domain: google.com(google maps), Name: khcookie Domain: google.com(google maps), Name: PREF and Domain: tripadvisor.com, Name: ServerPool Domain: tripadvisor.com, Name: TAReturnTo Domain: tripadvisor.com, Name: TAUnique Domain: tripadvisor.com, Name: v1st Thank you very much, Gino

    Read the article

  • android View not attached to window manager...

    - by Daniel Benedykt
    Hi I am having some of the following exceptions: java.lang.IllegalArgumentException: View not attached to window manager at android.view.WindowManagerImpl.findViewLocked(WindowManagerImpl.java:355) at android.view.WindowManagerImpl.updateViewLayout(WindowManagerImpl.java:191) at android.view.Window$LocalWindowManager.updateViewLayout(Window.java:428) at android.app.Dialog.onWindowAttributesChanged(Dialog.java:596) at android.view.Window.setDefaultWindowFormat(Window.java:1013) at com.android.internal.policy.impl.PhoneWindow.access$700(PhoneWindow.java:86) at com.android.internal.policy.impl.PhoneWindow$DecorView.drawableChanged(PhoneWindow.java:1951) at com.android.internal.policy.impl.PhoneWindow$DecorView.fitSystemWindows(PhoneWindow.java:1889) at android.view.ViewRoot.performTraversals(ViewRoot.java:727) at android.view.ViewRoot.handleMessage(ViewRoot.java:1633) at android.os.Handler.dispatchMessage(Handler.java:99) at android.os.Looper.loop(Looper.java:123) at android.app.ActivityThread.main(ActivityThread.java:4338) at java.lang.reflect.Method.invokeNative(Native Method) at java.lang.reflect.Method.invoke(Method.java:521) at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) at dalvik.system.NativeStart.main(Native Method) I have google it and see that it has something to do with popups and turning the screen, but there is no reference to my code. The questions are: 1) is there a way to find out exactly when this issue is happening? 2) other than turning the screen, is there another event or action that triggers this error? 3) how do I prevent this to happen? Thanks

    Read the article

  • MEX issues using WCF Test Client over net.pipe

    - by Beaud.
    I'm trying to make use of WCF Test Client along with named pipes but I get the following error: Error: Cannot obtain Metadata from net.pipe://localhost/MyService Here's my web.config: <system.serviceModel> <services> <service name="MyNamespace.MyService" behaviorConfiguration="MEX"> <endpoint address="net.pipe://localhost/MyService" binding="netNamedPipeBinding" contract="MyNamespace.MyService.IMyService" /> <endpoint address="net.pipe://localhost/MEX" binding="mexNamedPipeBinding" contract="IMetadataExchange" /> </service> </services> <client> <endpoint address="net.pipe://localhost/MyService" binding="netNamedPipeBinding" contract="MyNamespace.MyService.IMyService" /> </client> <behaviors> <serviceBehaviors> <behavior name="MEX"> <serviceMetadata /> </behavior> </serviceBehaviors> </behaviors> What's wrong? I have tried both net.pipe://localhost/MyService and net.pipe://localhost/MEX. Any help would be appreciated, thanks!

    Read the article

  • GetUserDefaultLocaleName() API is crashing

    - by Santhosha
    I have one application which reads user default locale in Windows Vista and above. When i tried calling the API for getting User default Locale API is crashing. Below is the code, It will be helpfull if any points the reason #include <iostream> #include <WinNls.h> #include <Windows.h> int main() { LPWSTR lpLocaleName=NULL; cout << "Calling GetUserDefaultLocaleName"; int ret = GetUserDefaultLocaleName(lpLocaleName, LOCALE_NAME_MAX_LENGTH); cout << lpLocaleName<<endl; }

    Read the article

< Previous Page | 825 826 827 828 829 830 831 832 833 834 835 836  | Next Page >